"CD27" Related Products

Expand
Expand
Expand

Recombinant Human CD27

Cat.No.: CD27-26925TH
Product Overview: Recombinant full length Human CD27 with N terminal proprietary tag; Predicted MWt 54.34 kDa.
Description: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity. It binds to ligand CD70, and plays a key role in regulating B-cell activation and immunoglobulin synthesis. This receptor transduces signals that lead to the activation of NF-kappaB and MAPK8/JNK. Adaptor proteins TRAF2 and TRAF5 have been shown to mediate the signaling process of this receptor. CD27-binding protein (SIVA), a proapoptotic protein, can bind to this receptor and is thought to play an important role in the apoptosis induced by this receptor.
Protein length: 260 amino acids
Molecular Weight: 54.340kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Found in most T-lymphocytes.
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCC QMCEPGTFLVKDCDQHRKAAQCDPCIPGVSFSPDHHTRPH CESCRHCNSGLLVRNCTITANAECACRNGWQCRDKECTEC DPLPNPSLTARSSQALSPHPQPTHLPYVSEMLEARTAGHM QTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMF LVFTLAGALFLHQRRKYRSNKGESPVEPAEPCRYSCPREE EGSTIPIQEDYRKPEPACSP
Sequence Similarities: Contains 3 TNFR-Cys repeats.
Gene Name: CD27 CD27 molecule [ Homo sapiens ]
Official Symbol: CD27
Synonyms: CD27; CD27 molecule; TNFRSF7, tumor necrosis factor receptor superfamily, member 7; CD27 antigen; S152; Tp55;
Gene ID: 939
mRNA Refseq: NM_001242
Protein Refseq: NP_001233
MIM: 186711
Uniprot ID: P26842
Chromosome Location: 12p13
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem;
Function: cysteine-type endopeptidase inhibitor activity involved in apoptotic process; protein binding; receptor activity; transmembrane signaling receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.