"CD274" Related Products

Recombinant Human CD274

Cat.No.: CD274-27112TH
Product Overview: Recombinant fragment corresponding to aa 141-240 of human CD274 with a proprietary tag; 36.63kDa inclusive of tag.
Description: Programmed cell death 1 ligand 1 (PD-L1) also known as cluster of differentiation (CD274) or B7 homolog 1 (B7-H1) is a protein that in humans is encoded by the CD274 gene.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Highly expressed in the heart, skeletal muscle, placenta and lung. Weakly expressed in the thymus, spleen, kidney and liver. Expressed on activated T- and B-cells, dendritic cells, keratinocytes and monocytes.
Biological activity: This product is useful for Antibody Production and Protein Array
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced.
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: ILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH
Sequence Similarities: Belongs to the immunoglobulin superfamily. BTN/MOG family.Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 Ig-like V-type (immunoglobulin-like) domain.
Gene Name: CD274 CD274 molecule [ Homo sapiens ]
Official Symbol: CD274
Synonyms: CD274; CD274 molecule; CD274 antigen , PDCD1LG1, programmed cell death 1 ligand 1; programmed cell death 1 ligand 1; B7 homolog 1; B7 H; B7 H1; B7H1; PD L1; PDL1;
Gene ID: 29126
mRNA Refseq: NM_014143
Protein Refseq: NP_054862
MIM: 605402
Uniprot ID: Q9NZQ7
Chromosome Location: 9p24.1
Pathway: Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem;
Function: protein binding; protein tyrosine phosphatase activity; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.