Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human CD36, His-tagged

Cat.No. : CD36-27868TH
Product Overview : Recombinant full length Human CD36 (amino acids 1-472) with a N terminal His tag; predicted MWt 77.99 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.
Protein length : 472 amino acids
Conjugation : HIS
Molecular Weight : 77.990kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKK QVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNS SNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGA IFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNS LINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGL FYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWE SHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFE SDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKII SKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPID GLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPS EKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTG KINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK
Sequence Similarities : Belongs to the CD36 family.
Gene Name : CD36 CD36 molecule (thrombospondin receptor) [ Homo sapiens ]
Official Symbol : CD36
Synonyms : CD36; CD36 molecule (thrombospondin receptor); CD36 antigen (collagen type I receptor, thrombospondin receptor); platelet glycoprotein 4; FAT; GP3B; GP4; GPIV; SCARB3;
Gene ID : 948
mRNA Refseq : NM_000072
Protein Refseq : NP_000063
MIM : 173510
Uniprot ID : P16671
Chromosome Location : 7q11.2
Pathway : Adaptive Immune System, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Antigen processing-Cross presentation, organism-specific biosystem; Class I MHC mediated antigen processing &
Function : Gram-negative bacterial cell surface binding; Gram-positive bacterial cell surface binding; high-density lipoprotein particle binding; lipid binding; lipoprotein particle binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (7)

Ask a question
What is the impact of CD36 on inflammation and the immune response, particularly in chronic inflammatory diseases? 01/23/2022

CD36 is involved in inflammation and immune responses, potentially exacerbating chronic inflammatory conditions.

How do alterations in CD36 expression or activity affect obesity and related health complications? 07/08/2021

Variations in CD36 function can influence the risk of obesity and associated health issues like metabolic syndrome.

What are the mechanisms by which CD36 modulates cell signaling and energy homeostasis? 03/15/2021

CD36 modulates cell signaling related to energy utilization and storage, impacting metabolic health.

How does CD36 contribute to the pathogenesis of metabolic disorders, such as insulin resistance and type 2 diabetes? 03/01/2021

CD36 affects the development of metabolic disorders by influencing lipid metabolism and insulin sensitivity.

How does CD36 influence taste perception, especially in the detection of dietary fats? 06/27/2020

CD36 aids in taste perception, particularly in detecting and responding to dietary fats.

What role does CD36 play in the development of cardiovascular diseases like atherosclerosis? 02/09/2020

CD36 is implicated in cardiovascular diseases, contributing to the formation of atherosclerotic plaques.

How does CD36 (Cluster of Differentiation 36) function in fatty acid metabolism and uptake? 08/27/2019

CD36 facilitates the uptake and metabolism of fatty acids in cells, playing a critical role in lipid processing.

Customer Reviews (3)

Write a review
Reviews
05/21/2020

    Dependable protein purification, consistently high-quality results.

    04/10/2019

      Great antibody validation, enhances our immunoprecipitation experiments.

      12/28/2018

        Swift protein expression optimization, invaluable for our research efficiency.

        Ask a Question for All CD36 Products

        Required fields are marked with *

        My Review for All CD36 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends