Recombinant Human CD3G

Cat.No. : CD3G-26368TH
Product Overview : Recombinant fragment of Human CD3G with proprietary tag; predicited MWt 35.42 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 89 amino acids
Description : The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency.
Molecular Weight : 35.420kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELN
Sequence Similarities : Contains 1 Ig-like (immunoglobulin-like) domain.Contains 1 ITAM domain.
Gene Name CD3G CD3g molecule, gamma (CD3-TCR complex) [ Homo sapiens ]
Official Symbol CD3G
Synonyms CD3G; CD3g molecule, gamma (CD3-TCR complex); CD3g antigen, gamma polypeptide (TiT3 complex); T-cell surface glycoprotein CD3 gamma chain;
Gene ID 917
mRNA Refseq NM_000073
Protein Refseq NP_000064
Uniprot ID P09693
Chromosome Location 11q23
Pathway Adaptive Immune System, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem;
Function T cell receptor binding; protein heterodimerization activity; receptor activity; receptor signaling complex scaffold activity; transmembrane signaling receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD3G Products

Required fields are marked with *

My Review for All CD3G Products

Required fields are marked with *

0
cart-icon
0
compare icon