"CD48" Related Products

Expand
Expand

Recombinant Human CD48

Cat.No.: CD48-26635TH
Product Overview: Recombinant full length Human CD48 with N terminal proprietary tag, 44.33kDa.
Description: BLAST1 is the designation used for an activation-associated cell surface glycoprotein of 40 to 45 kD expressed primarily in mitogen-stimulated human lymphocytes. The protein sequence predicted by the cDNA encoding BLAST1 indicates that BLAST1 is a member of the immunoglobulin supergene family. Yokoyama (1991) identified the BLAST1 activation/adhesion molecule as CD48.
Protein length: 169 amino acids
Molecular Weight: 44.330kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSN VTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESK FKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQE WKIKLQVLGESGEPKSKSPLQWPQMDHCRASWEAWGTLGE EERKTSGQV
Sequence Similarities: Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 Ig-like V-type (immunoglobulin-like) domain.
Gene Name: CD48 CD48 molecule [ Homo sapiens ]
Official Symbol: CD48
Synonyms: CD48; CD48 molecule; BCM1, CD48 antigen (B cell membrane protein) , CD48 molecule; CD48 antigen; BLAST; hCD48; mCD48; SLAMF2;
Gene ID: 962
mRNA Refseq: NM_001778
Protein Refseq: NP_001769
MIM: 109530
Uniprot ID: P09326
Chromosome Location: 1q21.3-q22
Pathway: Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Natural killer cell mediated cytotoxicity, organism-specific biosystem; Natural killer cell mediated cytotoxicity, conserved biosystem;
Function: antigen binding; eukaryotic cell surface binding; protein binding; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.