Recombinant Human CD48
| Cat.No. : | CD48-26635TH |
| Product Overview : | Recombinant full length Human CD48 with N terminal proprietary tag, 44.33kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 169 amino acids |
| Description : | BLAST1 is the designation used for an activation-associated cell surface glycoprotein of 40 to 45 kD expressed primarily in mitogen-stimulated human lymphocytes. The protein sequence predicted by the cDNA encoding BLAST1 indicates that BLAST1 is a member of the immunoglobulin supergene family. Yokoyama (1991) identified the BLAST1 activation/adhesion molecule as CD48. |
| Molecular Weight : | 44.330kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSN VTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESK FKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQE WKIKLQVLGESGEPKSKSPLQWPQMDHCRASWEAWGTLGE EERKTSGQV |
| Sequence Similarities : | Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
| Gene Name | CD48 CD48 molecule [ Homo sapiens ] |
| Official Symbol | CD48 |
| Synonyms | CD48; CD48 molecule; BCM1, CD48 antigen (B cell membrane protein) , CD48 molecule; CD48 antigen; BLAST; hCD48; mCD48; SLAMF2; |
| Gene ID | 962 |
| mRNA Refseq | NM_001778 |
| Protein Refseq | NP_001769 |
| MIM | 109530 |
| Uniprot ID | P09326 |
| Chromosome Location | 1q21.3-q22 |
| Pathway | Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Natural killer cell mediated cytotoxicity, organism-specific biosystem; Natural killer cell mediated cytotoxicity, conserved biosystem; |
| Function | antigen binding; eukaryotic cell surface binding; protein binding; receptor activity; |
| ◆ Recombinant Proteins | ||
| CD48-200H | Recombinant Human CD48 Protein, C-His-tagged | +Inquiry |
| CD48-252HAF555 | Recombinant Human CD48 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| CD48-26635TH | Recombinant Human CD48 | +Inquiry |
| CD48-2638H | Active Recombinant Human CD48 protein, hFc&His-tagged | +Inquiry |
| CD48-252H | Active Recombinant Human CD48 protein, hFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD48-3044HCL | Recombinant Human CD48 cell lysate | +Inquiry |
| CD48-1258RCL | Recombinant Rat CD48 cell lysate | +Inquiry |
| CD48-2468MCL | Recombinant Mouse CD48 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD48 Products
Required fields are marked with *
My Review for All CD48 Products
Required fields are marked with *
