Recombinant Human CD48
Cat.No. : | CD48-26635TH |
Product Overview : | Recombinant full length Human CD48 with N terminal proprietary tag, 44.33kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 169 amino acids |
Description : | BLAST1 is the designation used for an activation-associated cell surface glycoprotein of 40 to 45 kD expressed primarily in mitogen-stimulated human lymphocytes. The protein sequence predicted by the cDNA encoding BLAST1 indicates that BLAST1 is a member of the immunoglobulin supergene family. Yokoyama (1991) identified the BLAST1 activation/adhesion molecule as CD48. |
Molecular Weight : | 44.330kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSN VTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESK FKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQE WKIKLQVLGESGEPKSKSPLQWPQMDHCRASWEAWGTLGE EERKTSGQV |
Sequence Similarities : | Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
Gene Name | CD48 CD48 molecule [ Homo sapiens ] |
Official Symbol | CD48 |
Synonyms | CD48; CD48 molecule; BCM1, CD48 antigen (B cell membrane protein) , CD48 molecule; CD48 antigen; BLAST; hCD48; mCD48; SLAMF2; |
Gene ID | 962 |
mRNA Refseq | NM_001778 |
Protein Refseq | NP_001769 |
MIM | 109530 |
Uniprot ID | P09326 |
Chromosome Location | 1q21.3-q22 |
Pathway | Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Natural killer cell mediated cytotoxicity, organism-specific biosystem; Natural killer cell mediated cytotoxicity, conserved biosystem; |
Function | antigen binding; eukaryotic cell surface binding; protein binding; receptor activity; |
◆ Recombinant Proteins | ||
Cd48-8763RAF647 | Recombinant Rat Cd48 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
Cd48-1873R | Recombinant Rat Cd48 protein, His & T7-tagged | +Inquiry |
CD48-680H | Active Recombinant Human CD48, Fc-tagged, Biotinylated | +Inquiry |
CD48-3255H | Active Recombinant Human CD48 protein(Met1-Ser220), His&Avi-tagged, Biotinylated | +Inquiry |
CD48-2179H | Active Recombinant Human CD48 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD48-2468MCL | Recombinant Mouse CD48 cell lysate | +Inquiry |
CD48-1258RCL | Recombinant Rat CD48 cell lysate | +Inquiry |
CD48-3044HCL | Recombinant Human CD48 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD48 Products
Required fields are marked with *
My Review for All CD48 Products
Required fields are marked with *
0
Inquiry Basket