Recombinant Human CD97

• Cat.No.: CD97-26331TH
• Product Overview: Recombinant fragment of Human CD97 (aa 421-529) with a N terminal proprietary tag: predicted molecular weight 37.62 kDa, inclusive of tag.

Specification

• Description: This gene encodes a member of the EGF-TM7 subfamily of adhesion G protein-coupled receptors, which mediate cell-cell interactions. These proteins are cleaved by self-catalytic proteolysis into a large extracellular subunit and seven-span transmembrane subunit, which associate at the cell surface as a receptor complex. The encoded protein may play a role in cell adhesion as well as leukocyte recruitment, activation and migration, and contains multiple extracellular EGF-like repeats which mediate binding to chondroitin sulfate and the cell surface complement regulatory protein CD55. Expression of this gene may play a role in the progression of several types of cancer. Alternatively spliced transcript variants encoding multiple isoforms with 3 to 5 EGF-like repeats have been observed for this gene. This gene is found in a cluster with other EGF-TM7 genes on the short arm of chromosome 19.
• Protein length: 109 amino acids
• Molecular Weight: 37.620kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Broadly expressed, found on most hematopoietic cells, including activated lymphocytes, monocytes, macrophages, dendritic cells, and granulocytes. Expressed also abundantly by smooth muscle cells. Expressed in thyroid, colorectal, gastric, esophageal and p
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KKQAELEEIYESSIRGVQLRRLSAVNSIFLSHNNTKELNS PILFAFSHLESSDGEAGRDPPAKDVMPGPRQELLCAFWKS DSDRGGHWATEGCQVLGSKNGSTTCQCSH
• Sequence Similarities: Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.Contains 5 EGF-like domains.Contains 1 GPS domain.

Gene Information

• Gene Name: CD97 CD97 molecule [ Homo sapiens ]
• Official Symbol: CD97
• Synonyms: CD97; CD97 molecule; CD97 antigen; leukocyte antigen CD97; seven transmembrane helix receptor; seven span transmembrane protein; seven transmembrane; heterodimeric receptor associated with inflammation; TM7LN1
• Gene ID: 976
• mRNA Refseq: NM_001025160
• Protein Refseq: NP_001020331
• MIM: 601211
• Uniprot ID: P48960
• Chromosome Location: 19p13
• Pathway: Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class B Secretin-like, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by GPCR, organism-specific biosystem
• Function: G-protein coupled receptor activity; calcium ion binding; receptor activity; signal transducer activity; transmembrane signaling receptor activity