Recombinant Human CD97 CD97-26331TH

Recombinant Human CD97

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CD97

Recombinant Human CD97

CD97 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CD97-26331TH
Product Overview : Recombinant fragment of Human CD97 (aa 421-529) with a N terminal proprietary tag: predicted molecular weight 37.62 kDa, inclusive of tag.
Description : This gene encodes a member of the EGF-TM7 subfamily of adhesion G protein-coupled receptors, which mediate cell-cell interactions. These proteins are cleaved by self-catalytic proteolysis into a large extracellular subunit and seven-span transmembrane subunit, which associate at the cell surface as a receptor complex. The encoded protein may play a role in cell adhesion as well as leukocyte recruitment, activation and migration, and contains multiple extracellular EGF-like repeats which mediate binding to chondroitin sulfate and the cell surface complement regulatory protein CD55. Expression of this gene may play a role in the progression of several types of cancer. Alternatively spliced transcript variants encoding multiple isoforms with 3 to 5 EGF-like repeats have been observed for this gene. This gene is found in a cluster with other EGF-TM7 genes on the short arm of chromosome 19.
Protein length : 109 amino acids
Molecular Weight : 37.620kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Broadly expressed, found on most hematopoietic cells, including activated lymphocytes, monocytes, macrophages, dendritic cells, and granulocytes. Expressed also abundantly by smooth muscle cells. Expressed in thyroid, colorectal, gastric, esophageal and p
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KKQAELEEIYESSIRGVQLRRLSAVNSIFLSHNNTKELNS PILFAFSHLESSDGEAGRDPPAKDVMPGPRQELLCAFWKS DSDRGGHWATEGCQVLGSKNGSTTCQCSH
Sequence Similarities : Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.Contains 5 EGF-like domains.Contains 1 GPS domain.
Gene Name : CD97 CD97 molecule [ Homo sapiens ]
Official Symbol : CD97
Synonyms : CD97; CD97 molecule; CD97 antigen; leukocyte antigen CD97; seven transmembrane helix receptor; seven span transmembrane protein; seven transmembrane; heterodimeric receptor associated with inflammation; TM7LN1;
Gene ID : 976
mRNA Refseq : NM_001025160
Protein Refseq : NP_001020331
MIM : 601211
Uniprot ID : P48960
Chromosome Location : 19p13
Pathway : Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class B Secretin-like, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by GPCR, organism-specific biosystem;
Function : G-protein coupled receptor activity; calcium ion binding; receptor activity; signal transducer activity; transmembrane signaling receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy