Recombinant Human CDH17

• Cat.No.: CDH17-29102TH
• Product Overview: Recombinant fragment (amino acids 24-131) of Human LI Cadherin with proprietary tag at the N terminal; Predicted MW 37.51 kDa, inclusive of tag.

Specification

• Description: This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine. Alternative splicing results in multiple transcript variants.
• Protein length: 108 amino acids
• Molecular Weight: 37.510kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Expressed in the gastrointestinal tract and pancreatic duct. Not detected in kidney, lung, liver, brain, adrenal gland and skin.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: EGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELT GETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANG IIVEGPVPITIEVKDINDNRPTFLQSKY
• Sequence Similarities: Contains 7 cadherin domains.

Gene Information

• Gene Name: CDH17 cadherin 17, LI cadherin (liver-intestine) [ Homo sapiens ]
• Official Symbol: CDH17
• Synonyms: CDH17; cadherin 17, LI cadherin (liver-intestine); cadherin-17; cadherin; HPT 1
• Gene ID: 1015
• mRNA Refseq: NM_001144663
• Protein Refseq: NP_001138135
• MIM: 603017
• Uniprot ID: Q12864
• Chromosome Location: 8q22.1
• Function: calcium ion binding; proton-dependent oligopeptide secondary active transmembrane transporter activity; transporter activity