Recombinant Human CDH8
| Cat.No. : | CDH8-26742TH |
| Product Overview : | Recombinant fragment (amino acids 522-621) of Human Cadherin 8 with proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | This gene encodes a type II classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. The extracellular domain consists of 5 subdomains, each containing a cadherin motif, and appears to determine the specificity of the proteins homophilic cell adhesion activity. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. This particular cadherin is expressed in brain and is putatively involved in synaptic adhesion, axon outgrowth and guidance. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Mainly expressed in brain. Found in certain nerve cell lines, such as retinoblasts, glioma cells and neuroblasts. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | KDDPKNGHYFLYSLLPEMVNNPNFTIKKNEDNSLSILAKHNGFNRQKQEVYLLPIIISDSGNPPLSSTSTLTIRVCGCSNDGVVQSCNVEAYVLPIGLSM |
| Sequence Similarities : | Contains 5 cadherin domains. |
| Gene Name | CDH8 cadherin 8, type 2 [ Homo sapiens ] |
| Official Symbol | CDH8 |
| Synonyms | CDH8; cadherin 8, type 2; cadherin-8; |
| Gene ID | 1006 |
| mRNA Refseq | NM_001796 |
| Protein Refseq | NP_001787 |
| MIM | 603008 |
| Uniprot ID | P55286 |
| Chromosome Location | 16q22.1 |
| Pathway | Adherens junctions interactions, organism-specific biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; |
| Function | calcium ion binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDH8 Products
Required fields are marked with *
My Review for All CDH8 Products
Required fields are marked with *




