Recombinant Human CDKN1C

• Cat.No.: CDKN1C-30575TH
• Product Overview: Recombinant fragment (amino acids 1-100) of Human p57 Kip2 with proprietary 26 kDa tag; 100 amino acids (Predicted MW 11.45 kDa), 36.63 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene is imprinted, with preferential expression of the maternal allele. The encoded protein is a tight-binding, strong inhibitor of several G1 cyclin/Cdk complexes and a negative regulator of cell proliferation. Mutations in this gene are implicated in sporadic cancers and Beckwith-Wiedemann syndorome, suggesting that this gene is a tumor suppressor candidate. Three transcript variants encoding two different isoforms have been found for this gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Expressed in the heart, brain, lung, skeletal muscle, kidney, pancreas and testis. High levels are seen in the placenta while low levels are seen in the liver.
• Biological activity: useful for Antibody Production and Protein Array
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRC
• Sequence Similarities: Belongs to the CDI family.

Gene Information

• Gene Name: CDKN1C cyclin-dependent kinase inhibitor 1C (p57, Kip2) [ Homo sapiens ]
• Official Symbol: CDKN1C
• Synonyms: CDKN1C; cyclin-dependent kinase inhibitor 1C (p57, Kip2); Beckwith Wiedemann syndrome , BWCR, BWS; cyclin-dependent kinase inhibitor 1C; KIP2; P57
• Gene ID: 1028
• mRNA Refseq: NM_000076
• Protein Refseq: NP_000067
• MIM: 600856
• Uniprot ID: P49918
• Chromosome Location: 11p15.5
• Pathway: Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Endochondral Ossification, organism-specific biosystem; G1 to S cell cycle control, organism-specific biosystem
• Function: cyclin-dependent protein kinase inhibitor activity; protein binding; protein kinase inhibitor activity