"CDR2" Related Products

Expand
Expand

Recombinant Human CDR2

Cat.No.: CDR2-26473TH
Product Overview: Recombinant full length Human CDR2 protein with an N terminal proprietary tag; predicted mwt: 76.05 kDa with the tag.
Protein length: 454 amino acids
Molecular Weight: 76.050kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLD RNTELEDSVQQMYTTNQEQLQEIEYLTKQVELLRQMNEQH AKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIE CLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFAC LKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKK TVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGAT GAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLY VPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAG SDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKY EELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVA SGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEI DEQRTKYRSLSSHS
Sequence Similarities: Belongs to the CDR2 family.
Gene Name: CDR2 cerebellar degeneration-related protein 2, 62kDa [ Homo sapiens ]
Official Symbol: CDR2
Synonyms: CDR2; cerebellar degeneration-related protein 2, 62kDa; cerebellar degeneration related protein (62kD); cerebellar degeneration-related protein 2; CDR62; Yo; Yo paraneoplastic antigen;
Gene ID: 1039
mRNA Refseq: NM_001802
Protein Refseq: NP_001793
MIM: 117340
Uniprot ID: Q01850
Chromosome Location: 16p13.1-p12
Function: molecular_function; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.