Recombinant Human CDR2 Protein, GST-Tagged

Cat.No. : CDR2-1072H
Product Overview : Human CDR2 full-length ORF (AAH17503, 1 a.a. - 454 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CDR2 (Cerebellar Degeneration Related Protein 2) is a Protein Coding gene. Diseases associated with CDR2 include Cerebellar Degeneration and Paraneoplastic Cerebellar Degeneration. An important paralog of this gene is CDR2L.
Molecular Mass : 75.68 kDa
AA Sequence : MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQQMYTTNQEQLQEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEIDEQRTKYRSLSSHS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDR2 cerebellar degeneration-related protein 2, 62kDa [ Homo sapiens ]
Official Symbol CDR2
Synonyms CDR2; cerebellar degeneration-related protein 2, 62kDa; cerebellar degeneration related protein (62kD); cerebellar degeneration-related protein 2; CDR62; Yo; Yo paraneoplastic antigen; major Yo paraneoplastic antigen; paraneoplastic cerebellar degeneration-associated antigen;
Gene ID 1039
mRNA Refseq NM_001802
Protein Refseq NP_001793
MIM 117340
UniProt ID Q01850

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDR2 Products

Required fields are marked with *

My Review for All CDR2 Products

Required fields are marked with *

0
cart-icon
0
compare icon