Recombinant Human CDR2 Protein, GST-Tagged
Cat.No. : | CDR2-1072H |
Product Overview : | Human CDR2 full-length ORF (AAH17503, 1 a.a. - 454 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CDR2 (Cerebellar Degeneration Related Protein 2) is a Protein Coding gene. Diseases associated with CDR2 include Cerebellar Degeneration and Paraneoplastic Cerebellar Degeneration. An important paralog of this gene is CDR2L. |
Molecular Mass : | 75.68 kDa |
AA Sequence : | MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQQMYTTNQEQLQEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEIDEQRTKYRSLSSHS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDR2 cerebellar degeneration-related protein 2, 62kDa [ Homo sapiens ] |
Official Symbol | CDR2 |
Synonyms | CDR2; cerebellar degeneration-related protein 2, 62kDa; cerebellar degeneration related protein (62kD); cerebellar degeneration-related protein 2; CDR62; Yo; Yo paraneoplastic antigen; major Yo paraneoplastic antigen; paraneoplastic cerebellar degeneration-associated antigen; |
Gene ID | 1039 |
mRNA Refseq | NM_001802 |
Protein Refseq | NP_001793 |
MIM | 117340 |
UniProt ID | Q01850 |
◆ Recombinant Proteins | ||
CDR2-801R | Recombinant Rhesus monkey CDR2 Protein, His-tagged | +Inquiry |
CDR2-3169H | Recombinant Human CDR2 Protein, His-tagged | +Inquiry |
CDR2-3234M | Recombinant Mouse CDR2 Protein | +Inquiry |
CDR2-26471TH | Recombinant Human CDR2 | +Inquiry |
CDR2-2816H | Recombinant Human CDR2 protein(11-250 aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDR2-7607HCL | Recombinant Human CDR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDR2 Products
Required fields are marked with *
My Review for All CDR2 Products
Required fields are marked with *
0
Inquiry Basket