Recombinant Human CDR2 protein(191-450 aa), C-His-tagged

Cat.No. : CDR2-2817H
Product Overview : Recombinant Human CDR2 protein(Q01850)(191-450 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 191-450 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : DEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEIDEQRTKYRSL
Gene Name CDR2 cerebellar degeneration-related protein 2, 62kDa [ Homo sapiens ]
Official Symbol CDR2
Synonyms CDR2; cerebellar degeneration-related protein 2, 62kDa; cerebellar degeneration related protein (62kD); cerebellar degeneration-related protein 2; CDR62; Yo; Yo paraneoplastic antigen; major Yo paraneoplastic antigen; paraneoplastic cerebellar degeneration-associated antigen;
Gene ID 1039
mRNA Refseq NM_001802
Protein Refseq NP_001793
MIM 117340
UniProt ID Q01850

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDR2 Products

Required fields are marked with *

My Review for All CDR2 Products

Required fields are marked with *

0
cart-icon