Recombinant Human CDR2 protein(191-450 aa), C-His-tagged
Cat.No. : | CDR2-2817H |
Product Overview : | Recombinant Human CDR2 protein(Q01850)(191-450 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 191-450 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | DEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEIDEQRTKYRSL |
Gene Name | CDR2 cerebellar degeneration-related protein 2, 62kDa [ Homo sapiens ] |
Official Symbol | CDR2 |
Synonyms | CDR2; cerebellar degeneration-related protein 2, 62kDa; cerebellar degeneration related protein (62kD); cerebellar degeneration-related protein 2; CDR62; Yo; Yo paraneoplastic antigen; major Yo paraneoplastic antigen; paraneoplastic cerebellar degeneration-associated antigen; |
Gene ID | 1039 |
mRNA Refseq | NM_001802 |
Protein Refseq | NP_001793 |
MIM | 117340 |
UniProt ID | Q01850 |
◆ Recombinant Proteins | ||
CDR2-70HF | Recombinant Full Length Human CDR2 Protein | +Inquiry |
CDR2-3169H | Recombinant Human CDR2 Protein, His-tagged | +Inquiry |
CDR2-2816H | Recombinant Human CDR2 protein(11-250 aa), C-His-tagged | +Inquiry |
CDR2-1072H | Recombinant Human CDR2 Protein, GST-Tagged | +Inquiry |
CDR2-3249HF | Recombinant Full Length Human CDR2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDR2-7607HCL | Recombinant Human CDR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDR2 Products
Required fields are marked with *
My Review for All CDR2 Products
Required fields are marked with *
0
Inquiry Basket