Recombinant Human CDSN
| Cat.No. : | CDSN-27961TH |
| Product Overview : | Recombinant fragment of Human Corneodesmosin with N-terminal proprietary tag.Mol Wt 35.31 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 88 amino acids |
| Description : | This gene encodes a protein found in corneodesmosomes, which localize to human epidermis and other cornified squamous epithelia. During maturation of the cornified layers, the protein undergoes a series of cleavages, which are thought to be required for desquamation. The gene is located in the major histocompatibility complex (MHC) class I region on chromosome 6. |
| Molecular Weight : | 35.310kDa inclusive of tags |
| Tissue specificity : | Exclusively expressed in skin. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | KIILQPCGSKSSSSGHPCMSVSSLTLTGGPDGSPHPDPSAGAKPCGSSSAGKIPCRSIRDILAQVKPLGPQLADPEVFLPQGELLNSP* |
| Gene Name | CDSN corneodesmosin [ Homo sapiens ] |
| Official Symbol | CDSN |
| Synonyms | CDSN; corneodesmosin; D6S586E; |
| Gene ID | 1041 |
| mRNA Refseq | NM_001264 |
| Protein Refseq | NP_001255 |
| MIM | 602593 |
| Uniprot ID | Q15517 |
| Chromosome Location | 6p21.3 |
| Function | protein homodimerization activity; |
| ◆ Recombinant Proteins | ||
| CDSN-407H | Active Recombinant Human CDSN, His-tagged | +Inquiry |
| CDSN-26344TH | Recombinant Human CDSN | +Inquiry |
| CDSN-2649H | Recombinant Human CDSN Protein, His (Fc)-Avi-tagged | +Inquiry |
| CDSN-27961TH | Recombinant Human CDSN | +Inquiry |
| CDSN-1684H | Recombinant Human CDSN Protein (Lys33-Pro528), C-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDSN Products
Required fields are marked with *
My Review for All CDSN Products
Required fields are marked with *
