"CDSN" Related Products

Expand
Expand

Recombinant Human CDSN

Cat.No.: CDSN-27961TH
Product Overview: Recombinant fragment of Human Corneodesmosin with N-terminal proprietary tag.Mol Wt 35.31 kDa inclusive of tag.
Description: This gene encodes a protein found in corneodesmosomes, which localize to human epidermis and other cornified squamous epithelia. During maturation of the cornified layers, the protein undergoes a series of cleavages, which are thought to be required for desquamation. The gene is located in the major histocompatibility complex (MHC) class I region on chromosome 6.
Protein length: 88 amino acids
Molecular Weight: 35.310kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Exclusively expressed in skin.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KIILQPCGSKSSSSGHPCMSVSSLTLTGGPDGSPHPDPSAGAKPCGSSSAGKIPCRSIRDILAQVKPLGPQLADPEVFLPQGELLNSP*
Gene Name: CDSN corneodesmosin [ Homo sapiens ]
Official Symbol: CDSN
Synonyms: CDSN; corneodesmosin; D6S586E;
Gene ID: 1041
mRNA Refseq: NM_001264
Protein Refseq: NP_001255
MIM: 602593
Uniprot ID: Q15517
Chromosome Location: 6p21.3
Function: protein homodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.