Recombinant Human CDSN

Cat.No. : CDSN-27961TH
Product Overview : Recombinant fragment of Human Corneodesmosin with N-terminal proprietary tag.Mol Wt 35.31 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 88 amino acids
Description : This gene encodes a protein found in corneodesmosomes, which localize to human epidermis and other cornified squamous epithelia. During maturation of the cornified layers, the protein undergoes a series of cleavages, which are thought to be required for desquamation. The gene is located in the major histocompatibility complex (MHC) class I region on chromosome 6.
Molecular Weight : 35.310kDa inclusive of tags
Tissue specificity : Exclusively expressed in skin.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KIILQPCGSKSSSSGHPCMSVSSLTLTGGPDGSPHPDPSAGAKPCGSSSAGKIPCRSIRDILAQVKPLGPQLADPEVFLPQGELLNSP*
Gene Name CDSN corneodesmosin [ Homo sapiens ]
Official Symbol CDSN
Synonyms CDSN; corneodesmosin; D6S586E;
Gene ID 1041
mRNA Refseq NM_001264
Protein Refseq NP_001255
MIM 602593
Uniprot ID Q15517
Chromosome Location 6p21.3
Function protein homodimerization activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDSN Products

Required fields are marked with *

My Review for All CDSN Products

Required fields are marked with *

0
cart-icon
0
compare icon