Recombinant Human CDSN

• Cat.No.: CDSN-27961TH
• Product Overview: Recombinant fragment of Human Corneodesmosin with N-terminal proprietary tag.Mol Wt 35.31 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 88 amino acids
• Description: This gene encodes a protein found in corneodesmosomes, which localize to human epidermis and other cornified squamous epithelia. During maturation of the cornified layers, the protein undergoes a series of cleavages, which are thought to be required for desquamation. The gene is located in the major histocompatibility complex (MHC) class I region on chromosome 6.
• Molecular Weight: 35.310kDa inclusive of tags
• Tissue specificity: Exclusively expressed in skin.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KIILQPCGSKSSSSGHPCMSVSSLTLTGGPDGSPHPDPSAGAKPCGSSSAGKIPCRSIRDILAQVKPLGPQLADPEVFLPQGELLNSP*

Gene Information

• Gene Name: CDSN corneodesmosin [ Homo sapiens ]
• Official Symbol: CDSN
• Synonyms: CDSN; corneodesmosin; D6S586E
• Gene ID: 1041
• mRNA Refseq: NM_001264
• Protein Refseq: NP_001255
• MIM: 602593
• Uniprot ID: Q15517
• Chromosome Location: 6p21.3
• Function: protein homodimerization activity