Recombinant Human CDSN
Cat.No. : | CDSN-27961TH |
Product Overview : | Recombinant fragment of Human Corneodesmosin with N-terminal proprietary tag.Mol Wt 35.31 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 88 amino acids |
Description : | This gene encodes a protein found in corneodesmosomes, which localize to human epidermis and other cornified squamous epithelia. During maturation of the cornified layers, the protein undergoes a series of cleavages, which are thought to be required for desquamation. The gene is located in the major histocompatibility complex (MHC) class I region on chromosome 6. |
Molecular Weight : | 35.310kDa inclusive of tags |
Tissue specificity : | Exclusively expressed in skin. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KIILQPCGSKSSSSGHPCMSVSSLTLTGGPDGSPHPDPSAGAKPCGSSSAGKIPCRSIRDILAQVKPLGPQLADPEVFLPQGELLNSP* |
Gene Name | CDSN corneodesmosin [ Homo sapiens ] |
Official Symbol | CDSN |
Synonyms | CDSN; corneodesmosin; D6S586E; |
Gene ID | 1041 |
mRNA Refseq | NM_001264 |
Protein Refseq | NP_001255 |
MIM | 602593 |
Uniprot ID | Q15517 |
Chromosome Location | 6p21.3 |
Function | protein homodimerization activity; |
◆ Recombinant Proteins | ||
CDSN-3239M | Recombinant Mouse CDSN Protein | +Inquiry |
CDSN-27961TH | Recombinant Human CDSN | +Inquiry |
CDSN-629R | Recombinant Rhesus Macaque CDSN Protein, His (Fc)-Avi-tagged | +Inquiry |
Cdsn-1548M | Recombinant Mouse Cdsn Protein, His (Fc)-Avi-tagged | +Inquiry |
CDSN-1079H | Recombinant Human CDSN Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDSN Products
Required fields are marked with *
My Review for All CDSN Products
Required fields are marked with *