"CDX1" Related Products

Expand

Recombinant Human CDX1

Cat.No.: CDX1-27916TH
Product Overview: Recombinant fragment of Human Cdx1 with N-terminal proprietary tag. Predicted MW 35.53kDa.
Description: This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded DNA-binding protein regulates intestine-specific gene expression and enterocyte differentiation. It has been shown to induce expression of the intestinal alkaline phosphatase gene, and inhibit beta-catenin/T-cell factor transcriptional activity.
Protein length: 90 amino acids
Molecular Weight: 35.530kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Intestinal epithelium.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKK*
Sequence Similarities: Belongs to the Caudal homeobox family.Contains 1 homeobox DNA-binding domain.
Gene Name: CDX1 caudal type homeobox 1 [ Homo sapiens ]
Official Symbol: CDX1
Synonyms: CDX1; caudal type homeobox 1; caudal type homeo box transcription factor 1; homeobox protein CDX-1;
Gene ID: 1044
mRNA Refseq: NM_001804
Protein Refseq: NP_001795
MIM: 600746
Uniprot ID: P47902
Chromosome Location: 5q32
Pathway: Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem;
Function: transcription regulatory region sequence-specific DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.