Recombinant Human CDX1

• Cat.No.: CDX1-27916TH
• Product Overview: Recombinant fragment of Human Cdx1 with N-terminal proprietary tag. Predicted MW 35.53kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 90 amino acids
• Description: This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded DNA-binding protein regulates intestine-specific gene expression and enterocyte differentiation. It has been shown to induce expression of the intestinal alkaline phosphatase gene, and inhibit beta-catenin/T-cell factor transcriptional activity.
• Molecular Weight: 35.530kDa inclusive of tags
• Tissue specificity: Intestinal epithelium.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKK*
• Sequence Similarities: Belongs to the Caudal homeobox family.Contains 1 homeobox DNA-binding domain.

Gene Information

• Gene Name: CDX1 caudal type homeobox 1 [ Homo sapiens ]
• Official Symbol: CDX1
• Synonyms: CDX1; caudal type homeobox 1; caudal type homeo box transcription factor 1; homeobox protein CDX-1
• Gene ID: 1044
• mRNA Refseq: NM_001804
• Protein Refseq: NP_001795
• MIM: 600746
• Uniprot ID: P47902
• Chromosome Location: 5q32
• Pathway: Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem
• Function: transcription regulatory region sequence-specific DNA binding