Recombinant Human CDX1
Cat.No. : | CDX1-27916TH |
Product Overview : | Recombinant fragment of Human Cdx1 with N-terminal proprietary tag. Predicted MW 35.53kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 90 amino acids |
Description : | This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded DNA-binding protein regulates intestine-specific gene expression and enterocyte differentiation. It has been shown to induce expression of the intestinal alkaline phosphatase gene, and inhibit beta-catenin/T-cell factor transcriptional activity. |
Molecular Weight : | 35.530kDa inclusive of tags |
Tissue specificity : | Intestinal epithelium. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKK* |
Sequence Similarities : | Belongs to the Caudal homeobox family.Contains 1 homeobox DNA-binding domain. |
Gene Name | CDX1 caudal type homeobox 1 [ Homo sapiens ] |
Official Symbol | CDX1 |
Synonyms | CDX1; caudal type homeobox 1; caudal type homeo box transcription factor 1; homeobox protein CDX-1; |
Gene ID | 1044 |
mRNA Refseq | NM_001804 |
Protein Refseq | NP_001795 |
MIM | 600746 |
Uniprot ID | P47902 |
Chromosome Location | 5q32 |
Pathway | Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem; |
Function | transcription regulatory region sequence-specific DNA binding; |
◆ Recombinant Proteins | ||
CDX1-1551M | Recombinant Mouse CDX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDX1-6242C | Recombinant Chicken CDX1 | +Inquiry |
CDX1-11074H | Recombinant Human CDX1, His-tagged | +Inquiry |
CDX1-1082H | Recombinant Human CDX1 Protein, GST-Tagged | +Inquiry |
CDX1-27916TH | Recombinant Human CDX1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDX1-7603HCL | Recombinant Human CDX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDX1 Products
Required fields are marked with *
My Review for All CDX1 Products
Required fields are marked with *