"CEACAM6" Related Products

Expand
Expand

Recombinant Human CEACAM6

Cat.No.: CEACAM6-27919TH
Product Overview: Recombinant fragment of Human CEACAM6 with N-terminal proprietary tag. Predicted MW 37.73kDa.
Description: Carcinoembryonic antigen (CEA; MIM 114890) is one of the most widely used tumor markers in serum immunoassay determinations of carcinoma. An apparent lack of absolute cancer specificity for CEA probably results in part from the presence in normal and neoplastic tissues of antigens that share antigenic determinants with the 180-kD form of CEA (Barnett et al.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Sequences of amino acids: PVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSN GNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLY GPDVPTISPSKANYRPGENLNLSCHAASNP
Sequence Similarities: Belongs to the immunoglobulin superfamily. CEA family.Contains 2 Ig-like C2-type (immunoglobulin-like) domains.Contains 1 Ig-like V-type (immunoglobulin-like) domain.
Gene Name: CEACAM6 carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen) [ Homo sapiens ]
Official Symbol: CEACAM6
Synonyms: CEACAM6; carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen); NCA; carcinoembryonic antigen-related cell adhesion molecule 6; CD66c;
Gene ID: 4680
mRNA Refseq: NM_002483
Protein Refseq: NP_002474
MIM: 163980
Uniprot ID: P40199
Chromosome Location: 19q13.1-q13.2
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.