Recombinant Human CEACAM6

Cat.No. : CEACAM6-27919TH
Product Overview : Recombinant fragment of Human CEACAM6 with N-terminal proprietary tag. Predicted MW 37.73kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : Carcinoembryonic antigen (CEA; MIM 114890) is one of the most widely used tumor markers in serum immunoassay determinations of carcinoma. An apparent lack of absolute cancer specificity for CEA probably results in part from the presence in normal and neoplastic tissues of antigens that share antigenic determinants with the 180-kD form of CEA (Barnett et al.
Molecular Weight : 37.730kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Sequences of amino acids : PVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSN GNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLY GPDVPTISPSKANYRPGENLNLSCHAASNP
Sequence Similarities : Belongs to the immunoglobulin superfamily. CEA family.Contains 2 Ig-like C2-type (immunoglobulin-like) domains.Contains 1 Ig-like V-type (immunoglobulin-like) domain.
Gene Name CEACAM6 carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen) [ Homo sapiens ]
Official Symbol CEACAM6
Synonyms CEACAM6; carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen); NCA; carcinoembryonic antigen-related cell adhesion molecule 6; CD66c;
Gene ID 4680
mRNA Refseq NM_002483
Protein Refseq NP_002474
MIM 163980
Uniprot ID P40199
Chromosome Location 19q13.1-q13.2
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CEACAM6 Products

Required fields are marked with *

My Review for All CEACAM6 Products

Required fields are marked with *

0
cart-icon