Recombinant Human CEACAM6
Cat.No. : | CEACAM6-27919TH |
Product Overview : | Recombinant fragment of Human CEACAM6 with N-terminal proprietary tag. Predicted MW 37.73kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | Carcinoembryonic antigen (CEA; MIM 114890) is one of the most widely used tumor markers in serum immunoassay determinations of carcinoma. An apparent lack of absolute cancer specificity for CEA probably results in part from the presence in normal and neoplastic tissues of antigens that share antigenic determinants with the 180-kD form of CEA (Barnett et al. |
Molecular Weight : | 37.730kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Sequences of amino acids : | PVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSN GNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLY GPDVPTISPSKANYRPGENLNLSCHAASNP |
Sequence Similarities : | Belongs to the immunoglobulin superfamily. CEA family.Contains 2 Ig-like C2-type (immunoglobulin-like) domains.Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
Gene Name | CEACAM6 carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen) [ Homo sapiens ] |
Official Symbol | CEACAM6 |
Synonyms | CEACAM6; carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen); NCA; carcinoembryonic antigen-related cell adhesion molecule 6; CD66c; |
Gene ID | 4680 |
mRNA Refseq | NM_002483 |
Protein Refseq | NP_002474 |
MIM | 163980 |
Uniprot ID | P40199 |
Chromosome Location | 19q13.1-q13.2 |
Function | protein binding; |
◆ Recombinant Proteins | ||
CEACAM6-3191H | Recombinant Human CEACAM6 Protein, His-tagged | +Inquiry |
CEACAM6-1096H | Recombinant Human CEACAM6 Protein, GST-Tagged | +Inquiry |
CEACAM6-2193H | Active Recombinant Human CEACAM6 protein, His-tagged | +Inquiry |
CEACAM6-199H | Recombinant Human CEACAM6 protein, His-Avi-tagged | +Inquiry |
CEACAM6-1536C | Recombinant Cynomolgus CEACAM6 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEACAM6-2797HCL | Recombinant Human CEACAM6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEACAM6 Products
Required fields are marked with *
My Review for All CEACAM6 Products
Required fields are marked with *