Recombinant Human CEACAM6 protein, His-SUMO-tagged
Cat.No. : | CEACAM6-2684H |
Product Overview : | Recombinant Human CEACAM6 protein(P40199)(35-320aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 35-320aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.2 kDa |
AA Sequence : | KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CEACAM6 carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen) [ Homo sapiens ] |
Official Symbol | CEACAM6 |
Synonyms | CEACAM6; carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen); NCA; carcinoembryonic antigen-related cell adhesion molecule 6; CD66c; normal cross-reacting antigen; non-specific crossreacting antigen; CEAL; |
Gene ID | 4680 |
mRNA Refseq | NM_002483 |
Protein Refseq | NP_002474 |
MIM | 163980 |
UniProt ID | P40199 |
◆ Recombinant Proteins | ||
CEACAM6-199H | Recombinant Human CEACAM6 protein, His-Avi-tagged | +Inquiry |
CEACAM6-3275HF | Recombinant Full Length Human CEACAM6 Protein, GST-tagged | +Inquiry |
CEACAM6-1536C | Recombinant Cynomolgus CEACAM6 protein, His-tagged | +Inquiry |
CEACAM6-3191H | Recombinant Human CEACAM6 Protein, His-tagged | +Inquiry |
CEACAM6-3324H | Recombinant Human CEACAM6 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEACAM6-2797HCL | Recombinant Human CEACAM6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEACAM6 Products
Required fields are marked with *
My Review for All CEACAM6 Products
Required fields are marked with *