Recombinant Human CETN2, His-tagged

Cat.No. : CETN2-27957TH
Product Overview : Recombinant full length Human Centrin 2 with an N terminal His tag; 192 amino acids with tag, Predicted MWt 21.9 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 172 amino acids
Description : Caltractin belongs to a family of calcium-binding proteins and is a structural component of the centrosome.The high level of conservation from algae to humans and its association with the centrosome suggested that caltractin plays a fundamental role in the structure and function of the microtubule-organizing center, possibly required for the proper duplication and segregation of the centrosome.
Conjugation : HIS
Molecular Weight : 21.900kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride, 0.02% DTT
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMASNFKKANMASSSQRKRMS PKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRAL GFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEK DTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDE ELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
Sequence Similarities : Belongs to the centrin family.Contains 4 EF-hand domains.
Gene Name CETN2 centrin, EF-hand protein, 2 [ Homo sapiens ]
Official Symbol CETN2
Synonyms CETN2; centrin, EF-hand protein, 2; CALT; centrin-2; CEN2;
Gene ID 1069
mRNA Refseq NM_004344
Protein Refseq NP_004335
MIM 300006
Uniprot ID P41208
Chromosome Location Xq28
Pathway Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; G2/M Transition, organism-specific biosystem; Loss of Nlp from mitotic centrosomes, organism-specific biosystem; Loss of proteins required for interphase microtubule organization??from the centrosome, organism-specific biosystem;
Function ATP binding; ATP-dependent helicase activity; G-protein beta/gamma-subunit complex binding; calcium ion binding; nucleic acid binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CETN2 Products

Required fields are marked with *

My Review for All CETN2 Products

Required fields are marked with *

0
cart-icon
0
compare icon