Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human CETN2, His-tagged

Cat.No. : CETN2-27957TH
Product Overview : Recombinant full length Human Centrin 2 with an N terminal His tag; 192 amino acids with tag, Predicted MWt 21.9 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : Caltractin belongs to a family of calcium-binding proteins and is a structural component of the centrosome.The high level of conservation from algae to humans and its association with the centrosome suggested that caltractin plays a fundamental role in the structure and function of the microtubule-organizing center, possibly required for the proper duplication and segregation of the centrosome.
Protein length : 172 amino acids
Conjugation : HIS
Molecular Weight : 21.900kDa inclusive of tags
Source : E. coli
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride, 0.02% DTT
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMASNFKKANMASSSQRKRMS PKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRAL GFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEK DTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDE ELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
Sequence Similarities : Belongs to the centrin family.Contains 4 EF-hand domains.
Gene Name : CETN2 centrin, EF-hand protein, 2 [ Homo sapiens ]
Official Symbol : CETN2
Synonyms : CETN2; centrin, EF-hand protein, 2; CALT; centrin-2; CEN2;
Gene ID : 1069
mRNA Refseq : NM_004344
Protein Refseq : NP_004335
MIM : 300006
Uniprot ID : P41208
Chromosome Location : Xq28
Pathway : Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; G2/M Transition, organism-specific biosystem; Loss of Nlp from mitotic centrosomes, organism-specific biosystem; Loss of proteins required for interphase microtubule organization??from the centrosome, organism-specific biosystem;
Function : ATP binding; ATP-dependent helicase activity; G-protein beta/gamma-subunit complex binding; calcium ion binding; nucleic acid binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends