Recombinant Full Length Human CETN2 Protein, GST-tagged

• Cat.No.: CETN2-3289HF
• Product Overview: Human CETN2 full-length ORF (AAH05334, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 172 amino acids
• Description: Caltractin belongs to a family of calcium-binding proteins and is a structural component of the centrosome. The high level of conservation from algae to humans and its association with the centrosome suggested that caltractin plays a fundamental role in the structure and function of the microtubule-organizing center, possibly required for the proper duplication and segregation of the centrosome. [provided by RefSeq, Jul 2008]
• Molecular Mass: 44.66 kDa
• AA Sequence: MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CETN2 centrin, EF-hand protein, 2 [ Homo sapiens ]
• Official Symbol: CETN2
• Synonyms: CETN2; centrin, EF-hand protein, 2; CALT; centrin-2; CEN2; caltractin (20kD calcium-binding protein)
• Gene ID: 1069
• mRNA Refseq: NM_004344
• Protein Refseq: NP_004335
• MIM: 300006
• UniProt ID: P41208