Recombinant Full Length Human CETN2 Protein, GST-tagged
| Cat.No. : | CETN2-3289HF |
| Product Overview : | Human CETN2 full-length ORF (AAH05334, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 172 amino acids |
| Description : | Caltractin belongs to a family of calcium-binding proteins and is a structural component of the centrosome. The high level of conservation from algae to humans and its association with the centrosome suggested that caltractin plays a fundamental role in the structure and function of the microtubule-organizing center, possibly required for the proper duplication and segregation of the centrosome. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 44.66 kDa |
| AA Sequence : | MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CETN2 centrin, EF-hand protein, 2 [ Homo sapiens ] |
| Official Symbol | CETN2 |
| Synonyms | CETN2; centrin, EF-hand protein, 2; CALT; centrin-2; CEN2; caltractin (20kD calcium-binding protein); |
| Gene ID | 1069 |
| mRNA Refseq | NM_004344 |
| Protein Refseq | NP_004335 |
| MIM | 300006 |
| UniProt ID | P41208 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CETN2 Products
Required fields are marked with *
My Review for All CETN2 Products
Required fields are marked with *



