Recombinant Full Length Human CETN2 Protein, GST-tagged
Cat.No. : | CETN2-3289HF |
Product Overview : | Human CETN2 full-length ORF (AAH05334, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 172 amino acids |
Description : | Caltractin belongs to a family of calcium-binding proteins and is a structural component of the centrosome. The high level of conservation from algae to humans and its association with the centrosome suggested that caltractin plays a fundamental role in the structure and function of the microtubule-organizing center, possibly required for the proper duplication and segregation of the centrosome. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 44.66 kDa |
AA Sequence : | MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CETN2 centrin, EF-hand protein, 2 [ Homo sapiens ] |
Official Symbol | CETN2 |
Synonyms | CETN2; centrin, EF-hand protein, 2; CALT; centrin-2; CEN2; caltractin (20kD calcium-binding protein); |
Gene ID | 1069 |
mRNA Refseq | NM_004344 |
Protein Refseq | NP_004335 |
MIM | 300006 |
UniProt ID | P41208 |
◆ Recombinant Proteins | ||
CETN2-11129H | Recombinant Human CETN2, His-tagged | +Inquiry |
CETN2-3289HF | Recombinant Full Length Human CETN2 Protein, GST-tagged | +Inquiry |
CETN2-0993H | Recombinant Human CETN2 Protein (Met1-Leu171), N-His tagged | +Inquiry |
CETN2-1812H | Recombinant Human CETN2 protein, GST-tagged | +Inquiry |
CETN2-639H | Recombinant Human CETN2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CETN2-7561HCL | Recombinant Human CETN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CETN2 Products
Required fields are marked with *
My Review for All CETN2 Products
Required fields are marked with *
0
Inquiry Basket