Recombinant Human CFHR1 protein, GST-tagged
| Cat.No. : | CFHR1-27138TH |
| Product Overview : | Recombinant Human CFHR1(19 a.a. - 330 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
| Availability | January 17, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 19-330 a.a. |
| Description : | This gene encodes a secreted protein belonging to the complement factor H protein family. It binds to Pseudomonas aeruginosa elongation factor Tuf together with plasminogen, which is proteolytically activated. It is proposed that Tuf acts as a virulence factor by acquiring host proteins to the pathogen surface, controlling complement, and facilitating tissue invasion. Mutations in this gene are associated with an increased risk of atypical hemolytic-uremic syndrome. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 60.06 kDa |
| AA Sequence : | EATFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCTEEGWSPTPKCLRLCFFPFVE NGHSESSGQTHLEGDTVQIICNTGYRLQNNENNISCVERGWSTPPKCRSTDTSCVNPPTVQNAHILSRQMSKYPS GERVRYECRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQL EGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYLRTGESAEFVCKRGYRLSSRSHTLRTTCW DGKLEYPTCAKR |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | CFHR1 complement factor H-related 1 [ Homo sapiens ] |
| Official Symbol | CFHR1 |
| Synonyms | CFHR1; complement factor H-related 1; CFHL1, CFHL1P, CFHR1P, complement factor H related 1 pseudogene , H factor (complement) like 1 , H factor (complement) like 2 , HFL1, HFL2; complement factor H-related protein 1; CFHL; FHR1; H36 1; H36 2; H36; FHR-1; H-factor-like 1; h factor-like protein 1; H factor (complement)-like 1; H factor (complement)-like 2; complement factor H-related 1 pseudogene; HFL1; HFL2; CFHL1; H36-1; H36-2; CFHL1P; CFHR1P; MGC104329; |
| Gene ID | 3078 |
| mRNA Refseq | NM_002113 |
| Protein Refseq | NP_002104 |
| MIM | 134371 |
| UniProt ID | Q03591 |
| Chromosome Location | 1q32 |
| ◆ Recombinant Proteins | ||
| CFHR1-268H | Recombinant Human CFHR1, His-tagged | +Inquiry |
| CFHR1-1000H | Recombinant Human CFHR1 Protein (Glu19-Arg330), C-His tagged | +Inquiry |
| CFHR1-269H | Recombinant Human CFHR1, His-tagged | +Inquiry |
| CFHR1-8555H | Recombinant Human CFHR1 protein(Met1-Arg330), His-tagged | +Inquiry |
| CFHR1-764H | Recombinant Human CFHR1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CFHR1-1289HCL | Recombinant Human CFHR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFHR1 Products
Required fields are marked with *
My Review for All CFHR1 Products
Required fields are marked with *
