"CFL2" Related Products

Expand
Expand

Recombinant Human CFL2

Cat.No.: CFL2-26779TH
Product Overview: Recombinant full length Human Cofilin 2 with N terminal proprietary tag; Predicted MWt 44.33 kDa including the tag.
Description: This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants.
Protein length: 166 amino acids
Molecular Weight: 44.330kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Isoform CFL2b is expressed predominantly in skeletal muscle and heart. Isoform CFL2a is expressed in various tissues.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCL SDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDC RYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVS LEGKPL
Sequence Similarities: Belongs to the actin-binding proteins ADF family.Contains 1 ADF-H domain.
Gene Name: CFL2 cofilin 2 (muscle) [ Homo sapiens ]
Official Symbol: CFL2
Synonyms: CFL2; cofilin 2 (muscle); cofilin-2;
Gene ID: 1073
mRNA Refseq: NM_001243645
Protein Refseq: NP_001230574
MIM: 601443
Uniprot ID: Q9Y281
Chromosome Location: 14q13.2
Pathway: Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Caspase cascade in apoptosis, organism-specific biosystem; Fc gamma R-mediated phagocytosis, organism-specific biosystem; Fc gamma R-mediated phagocytosis, conserved biosystem;
Function: actin binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.