Recombinant Human CFL2 Protein, GST-Tagged

Cat.No. : CFL2-1174H
Product Overview : Human CFL2 full-length ORF (NP_068733.1, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2009]
Molecular Mass : 45.1 kDa
AA Sequence : MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CFL2 cofilin 2 (muscle) [ Homo sapiens ]
Official Symbol CFL2
Synonyms CFL2; cofilin 2 (muscle); cofilin-2; cofilin, muscle isoform; NEM7;
Gene ID 1073
mRNA Refseq NM_001243645
Protein Refseq NP_001230574
MIM 601443
UniProt ID Q9Y281

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CFL2 Products

Required fields are marked with *

My Review for All CFL2 Products

Required fields are marked with *

0
cart-icon
0
compare icon