Cat.No.:	CFL2-26843TH
Product Overview:	Recombinant full length Human Cofilin 2 with an N terminal His tag; 186aa, 20.9kDa inclusive of tag.
Description:	This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants.
Protein length:	166 amino acids
Conjugation:	HIS
Molecular Weight:	20.900kDa inclusive of tags
Source:	E. coli
Tissue specificity:	Isoform CFL2b is expressed predominantly in skeletal muscle and heart. Isoform CFL2a is expressed in various tissues.
Form:	Liquid
Purity:	>90% by SDS-PAGE
Storage buffer:	pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.04% DTT, 0.29% Sodium chloride
Storage:	Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids:	MGSSHHHHHHSSGLVPRGSHMASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
Sequence Similarities:	Belongs to the actin-binding proteins ADF family.Contains 1 ADF-H domain.

Gene Name:	CFL2 cofilin 2 (muscle) [ Homo sapiens ]
Official Symbol:	CFL2
Synonyms:	CFL2; cofilin 2 (muscle); cofilin-2;
Gene ID:	1073
mRNA Refseq:	NM_001243645
Protein Refseq:	NP_001230574
MIM:	601443
Uniprot ID:	Q9Y281
Chromosome Location:	14q13.2
Pathway:	Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Caspase cascade in apoptosis, organism-specific biosystem; Fc gamma R-mediated phagocytosis, organism-specific biosystem; Fc gamma R-mediated phagocytosis, conserved biosystem;
Function:	actin binding; protein binding;

Online Inquiry