Recombinant Human CFL2, His-tagged

• Cat.No.: CFL2-26843TH
• Product Overview: Recombinant full length Human Cofilin 2 with an N terminal His tag; 186aa, 20.9kDa inclusive of tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 166 amino acids
• Description: This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants.
• Conjugation: HIS
• Molecular Weight: 20.900kDa inclusive of tags
• Tissue specificity: Isoform CFL2b is expressed predominantly in skeletal muscle and heart. Isoform CFL2a is expressed in various tissues.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.04% DTT, 0.29% Sodium chloride
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
• Sequence Similarities: Belongs to the actin-binding proteins ADF family.Contains 1 ADF-H domain.

Gene Information

• Gene Name: CFL2 cofilin 2 (muscle) [ Homo sapiens ]
• Official Symbol: CFL2
• Synonyms: CFL2; cofilin 2 (muscle); cofilin-2
• Gene ID: 1073
• mRNA Refseq: NM_001243645
• Protein Refseq: NP_001230574
• MIM: 601443
• Uniprot ID: Q9Y281
• Chromosome Location: 14q13.2
• Pathway: Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Caspase cascade in apoptosis, organism-specific biosystem; Fc gamma R-mediated phagocytosis, organism-specific biosystem; Fc gamma R-mediated phagocytosis, conserved biosystem
• Function: actin binding; protein binding