Recombinant Human CFL2, His-tagged
Cat.No. : | CFL2-26843TH |
Product Overview : | Recombinant full length Human Cofilin 2 with an N terminal His tag; 186aa, 20.9kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 166 amino acids |
Description : | This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants. |
Conjugation : | HIS |
Molecular Weight : | 20.900kDa inclusive of tags |
Tissue specificity : | Isoform CFL2b is expressed predominantly in skeletal muscle and heart. Isoform CFL2a is expressed in various tissues. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.04% DTT, 0.29% Sodium chloride |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL |
Sequence Similarities : | Belongs to the actin-binding proteins ADF family.Contains 1 ADF-H domain. |
Gene Name | CFL2 cofilin 2 (muscle) [ Homo sapiens ] |
Official Symbol | CFL2 |
Synonyms | CFL2; cofilin 2 (muscle); cofilin-2; |
Gene ID | 1073 |
mRNA Refseq | NM_001243645 |
Protein Refseq | NP_001230574 |
MIM | 601443 |
Uniprot ID | Q9Y281 |
Chromosome Location | 14q13.2 |
Pathway | Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Caspase cascade in apoptosis, organism-specific biosystem; Fc gamma R-mediated phagocytosis, organism-specific biosystem; Fc gamma R-mediated phagocytosis, conserved biosystem; |
Function | actin binding; protein binding; |
◆ Recombinant Proteins | ||
CFL2-3297HF | Recombinant Full Length Human CFL2 Protein, GST-tagged | +Inquiry |
CFL2-2466HF | Active Recombinant Full Length Human CFL2 Protein, GST-tagged | +Inquiry |
CFL2-3351M | Recombinant Mouse CFL2 Protein | +Inquiry |
CFL2-655R | Recombinant Rhesus Macaque CFL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CFL2-11143H | Recombinant Human CFL2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFL2-7554HCL | Recombinant Human CFL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFL2 Products
Required fields are marked with *
My Review for All CFL2 Products
Required fields are marked with *