Recombinant Human CFP

• Cat.No.: CFP-29037TH
• Product Overview: Recombinant fragment of Human Properdin with a N terminal proprietary tag; Predicted MWt 39.05 kDa including the tag.

Specification

• Description: This gene encodes a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system. This protein binds to many microbial surfaces and apoptotic cells and stabilizes the C3- and C5-convertase enzyme complexes in a feedback loop that ultimately leads to formation of the membrane attack complex and lysis of the target cell. Mutations in this gene result in two forms of properdin deficiency, which results in high susceptibility to meningococcal infections. Multiple alternatively spliced variants, encoding the same protein, have been identified.
• Protein length: 122 amino acids
• Molecular Weight: 39.050kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLP PCPVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHG GPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNM KS
• Sequence Similarities: Contains 6 TSP type-1 domains.

Gene Information

• Gene Name: CFP complement factor properdin [ Homo sapiens ]
• Official Symbol: CFP
• Synonyms: CFP; complement factor properdin; PFC, properdin P factor, complement; properdin
• Gene ID: 5199
• mRNA Refseq: NM_001145252
• Protein Refseq: NP_001138724
• MIM: 300383
• Uniprot ID: P27918
• Chromosome Location: Xp11.4
• Pathway: Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem

Reviews

10/11/2022

They actively engage with the scientific community, staying up-to-date with the latest advancements related to CFP protein and sharing this valuable information.

12/25/2018

To summarize, the CFP protein provided by the manufacturer is of exceptional quality and perfectly aligns with my experimental requirements.

07/24/2017

This reliable supply chain management guarantees uninterrupted access to the protein, allowing me to plan and conduct my experiments with confidence and without concern for availability issues.

Q&As

Are there any genetic factors that influence CFP protein levels?

Yes, genetic factors can influence CFP protein levels, and certain genetic variants may increase the risk of complement-related disorders.

Can CFP protein levels be used as a diagnostic marker for certain diseases?

Yes, altered CFP protein levels are associated with several diseases, and measuring these levels can aid in diagnosis.

Are there any clinical trials involving CFP protein?

Some clinical trials may be investigating the use of CFP protein or related therapies for specific diseases. You can check clinical trial databases for current studies.

Can CFP protein be used in the treatment of COVID-19?

Research has explored the use of CFP protein and other complement system components in the context of COVID-19, but their clinical use is still under investigation.

How is CFP protein produced for clinical use?

CFP protein can be produced through recombinant DNA technology or extracted from human plasma for clinical applications.