"CHD4" Related Products

Expand

Recombinant Human CHD4

Cat.No.: CHD4-27065TH
Product Overview: Recombinant fragment of Human CHD4 protein with an N terminal proprietary tag; predicted MWt: 36.52 kDa inclusive of tag.
Description: The product of this gene belongs to the SNF2/RAD54 helicase family. It represents the main component of the nucleosome remodeling and deacetylase complex and plays an important role in epigenetic transcriptional repression. Patients with dermatomyositis develop antibodies against this protein.
Protein length: 99 amino acids
Molecular Weight: 36.520kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: ETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWH
Sequence Similarities: Belongs to the SNF2/RAD54 helicase family.Contains 2 chromo domains.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.Contains 2 PHD-type zinc fingers.
Gene Name: CHD4 chromodomain helicase DNA binding protein 4 [ Homo sapiens ]
Official Symbol: CHD4
Synonyms: CHD4; chromodomain helicase DNA binding protein 4; chromodomain-helicase-DNA-binding protein 4; Mi 2b; Mi2 BETA;
Gene ID: 1108
mRNA Refseq: NM_001273
Protein Refseq: NP_001264
MIM: 603277
Uniprot ID: Q14839
Chromosome Location: 12p13
Pathway: Signaling events mediated by HDAC Class I, organism-specific biosystem;
Function: ATP binding; ATP-dependent DNA helicase activity; DNA binding; helicase activity; hydrolase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.