Recombinant Human CHD4 protein, GST-tagged
Cat.No. : | CHD4-2793H |
Product Overview : | Recombinant Human CHD4(635 a.a. - 734 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 635-734 a.a. |
Description : | The product of this gene belongs to the SNF2/RAD54 helicase family. It represents the main component of the nucleosome remodeling and deacetylase complex and plays an important role in epigenetic transcriptional repression. Patients with dermatomyositis develop antibodies against this protein. Somatic mutations in this gene are associated with serous endometrial tumors. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | AADADVDPNIGPYVFELPFVPAAVRKNWTITRLNGDYAQLSLRILYLEAGMYDVPIIVTDSGNPPLSNTSIIKVK VCPCDDNGDCTTIGAVAAAGLGTGA |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CHD4 chromodomain helicase DNA binding protein 4 [ Homo sapiens ] |
Official Symbol | CHD4 |
Synonyms | CHD4; chromodomain helicase DNA binding protein 4; chromodomain-helicase-DNA-binding protein 4; Mi 2b; Mi2 BETA; CHD-4; ATP-dependent helicase CHD4; Mi-2 autoantigen 218 kDa protein; Mi-2b; Mi2-BETA; DKFZp686E06161; |
Gene ID | 1108 |
mRNA Refseq | NM_001273 |
Protein Refseq | NP_001264 |
MIM | 603277 |
UniProt ID | Q14839 |
Chromosome Location | 12p13 |
Pathway | Signaling events mediated by HDAC Class I, organism-specific biosystem; |
Function | ATP binding; ATP-dependent DNA helicase activity; DNA binding; helicase activity; hydrolase activity; hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides; metal ion binding; nucleotide binding; protein binding; transcription factor binding; zinc ion binding; |
◆ Recombinant Proteins | ||
CHD4-2434H | Recombinant Human CHD4 protein, His-tagged | +Inquiry |
CHD4-5153H | Recombinant Human CHD4 protein, His&His-tagged | +Inquiry |
CHD4-1632M | Recombinant Mouse CHD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHD4-27065TH | Recombinant Human CHD4 | +Inquiry |
CHD4-772H | Recombinant Human CHD4 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHD4-346HCL | Recombinant Human CHD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHD4 Products
Required fields are marked with *
My Review for All CHD4 Products
Required fields are marked with *