Recombinant Human CHD4 protein, GST-tagged

Cat.No. : CHD4-2793H
Product Overview : Recombinant Human CHD4(635 a.a. - 734 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 635-734 a.a.
Description : The product of this gene belongs to the SNF2/RAD54 helicase family. It represents the main component of the nucleosome remodeling and deacetylase complex and plays an important role in epigenetic transcriptional repression. Patients with dermatomyositis develop antibodies against this protein. Somatic mutations in this gene are associated with serous endometrial tumors. Alternative splicing results in multiple transcript variants encoding different isoforms.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : AADADVDPNIGPYVFELPFVPAAVRKNWTITRLNGDYAQLSLRILYLEAGMYDVPIIVTDSGNPPLSNTSIIKVK VCPCDDNGDCTTIGAVAAAGLGTGA
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name CHD4 chromodomain helicase DNA binding protein 4 [ Homo sapiens ]
Official Symbol CHD4
Synonyms CHD4; chromodomain helicase DNA binding protein 4; chromodomain-helicase-DNA-binding protein 4; Mi 2b; Mi2 BETA; CHD-4; ATP-dependent helicase CHD4; Mi-2 autoantigen 218 kDa protein; Mi-2b; Mi2-BETA; DKFZp686E06161;
Gene ID 1108
mRNA Refseq NM_001273
Protein Refseq NP_001264
MIM 603277
UniProt ID Q14839
Chromosome Location 12p13
Pathway Signaling events mediated by HDAC Class I, organism-specific biosystem;
Function ATP binding; ATP-dependent DNA helicase activity; DNA binding; helicase activity; hydrolase activity; hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides; metal ion binding; nucleotide binding; protein binding; transcription factor binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHD4 Products

Required fields are marked with *

My Review for All CHD4 Products

Required fields are marked with *

0
cart-icon
0
compare icon