"CHIT1" Related Products

Expand
Expand

Recombinant Human CHIT1

Cat.No.: CHIT1-27067TH
Product Overview: Recombinant fragment of Human CHIT1 with N terminal proprietary tag; Predicted MW 37.3 kDa
Description: Chitotriosidase is secreted by activated human macrophages and is markedly elevated in plasma of Gaucher disease patients. The expression of chitotriosidase occurs only at a late stage of differentiation of monocytes to activated macrophages in culture. Human macrophages can synthesize a functional chitotriosidase, a highly conserved enzyme with a strongly regulated expression. This enzyme may play a role in the degradation of chitin-containing pathogens.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Detected in spleen. Secreted by cultured macrophages.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGW NFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDW EYPGSQGSPAVDKERFTTLVQDLANAFQQE
Sequence Similarities: Belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily.Contains 1 chitin-binding type-2 domain.
Gene Name: CHIT1 chitinase 1 (chitotriosidase) [ Homo sapiens ]
Official Symbol: CHIT1
Synonyms: CHIT1; chitinase 1 (chitotriosidase); chitotriosidase-1; CHI3; CHIT;
Gene ID: 1118
mRNA Refseq: NM_003465
Protein Refseq: NP_003456
MIM: 600031
Uniprot ID: Q13231
Chromosome Location: 1q31-q32
Pathway: Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem;
Function: cation binding; chitin binding; chitinase activity; endochitinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.