Recombinant Human CHIT1
| Cat.No. : | CHIT1-27067TH |
| Product Overview : | Recombinant fragment of Human CHIT1 with N terminal proprietary tag; Predicted MW 37.3 kDa |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 110 amino acids |
| Description : | Chitotriosidase is secreted by activated human macrophages and is markedly elevated in plasma of Gaucher disease patients. The expression of chitotriosidase occurs only at a late stage of differentiation of monocytes to activated macrophages in culture. Human macrophages can synthesize a functional chitotriosidase, a highly conserved enzyme with a strongly regulated expression. This enzyme may play a role in the degradation of chitin-containing pathogens. |
| Molecular Weight : | 37.730kDa inclusive of tags |
| Tissue specificity : | Detected in spleen. Secreted by cultured macrophages. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | GMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGW NFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDW EYPGSQGSPAVDKERFTTLVQDLANAFQQE |
| Sequence Similarities : | Belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily.Contains 1 chitin-binding type-2 domain. |
| Gene Name | CHIT1 chitinase 1 (chitotriosidase) [ Homo sapiens ] |
| Official Symbol | CHIT1 |
| Synonyms | CHIT1; chitinase 1 (chitotriosidase); chitotriosidase-1; CHI3; CHIT; |
| Gene ID | 1118 |
| mRNA Refseq | NM_003465 |
| Protein Refseq | NP_003456 |
| MIM | 600031 |
| Uniprot ID | Q13231 |
| Chromosome Location | 1q31-q32 |
| Pathway | Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; |
| Function | cation binding; chitin binding; chitinase activity; endochitinase activity; |
| ◆ Recombinant Proteins | ||
| CHIT1-27067TH | Recombinant Human CHIT1 | +Inquiry |
| CHIT1-787H | Recombinant Human CHIT1 Protein | +Inquiry |
| CHIT1-658H | Recombinant Human CHIT1, His tagged | +Inquiry |
| CHIT1-11177H | Recombinant Human CHIT1, GST-tagged | +Inquiry |
| CHIT1-3200HF | Recombinant Full Length Human CHIT1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHIT1-2533HCL | Recombinant Human CHIT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHIT1 Products
Required fields are marked with *
My Review for All CHIT1 Products
Required fields are marked with *




