Recombinant Human CHIT1
Cat.No. : | CHIT1-27067TH |
Product Overview : | Recombinant fragment of Human CHIT1 with N terminal proprietary tag; Predicted MW 37.3 kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | Chitotriosidase is secreted by activated human macrophages and is markedly elevated in plasma of Gaucher disease patients. The expression of chitotriosidase occurs only at a late stage of differentiation of monocytes to activated macrophages in culture. Human macrophages can synthesize a functional chitotriosidase, a highly conserved enzyme with a strongly regulated expression. This enzyme may play a role in the degradation of chitin-containing pathogens. |
Molecular Weight : | 37.730kDa inclusive of tags |
Tissue specificity : | Detected in spleen. Secreted by cultured macrophages. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGW NFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDW EYPGSQGSPAVDKERFTTLVQDLANAFQQE |
Sequence Similarities : | Belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily.Contains 1 chitin-binding type-2 domain. |
Gene Name | CHIT1 chitinase 1 (chitotriosidase) [ Homo sapiens ] |
Official Symbol | CHIT1 |
Synonyms | CHIT1; chitinase 1 (chitotriosidase); chitotriosidase-1; CHI3; CHIT; |
Gene ID | 1118 |
mRNA Refseq | NM_003465 |
Protein Refseq | NP_003456 |
MIM | 600031 |
Uniprot ID | Q13231 |
Chromosome Location | 1q31-q32 |
Pathway | Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; |
Function | cation binding; chitin binding; chitinase activity; endochitinase activity; |
◆ Recombinant Proteins | ||
CHIT1-1718H | Recombinant Human CHIT1 Protein (Ala193-Asn466), N-His tagged | +Inquiry |
Chit1-1673M | Recombinant Mouse Chit1 protein, His & T7-tagged | +Inquiry |
CHIT1-11177H | Recombinant Human CHIT1, GST-tagged | +Inquiry |
CHIT1-27067TH | Recombinant Human CHIT1 | +Inquiry |
CHIT1-1719H | Recombinant Human CHIT1 Protein (Ala22-Asn466), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHIT1-2533HCL | Recombinant Human CHIT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHIT1 Products
Required fields are marked with *
My Review for All CHIT1 Products
Required fields are marked with *