Recombinant Human CHIT1

• Cat.No.: CHIT1-27067TH
• Product Overview: Recombinant fragment of Human CHIT1 with N terminal proprietary tag; Predicted MW 37.3 kDa

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 110 amino acids
• Description: Chitotriosidase is secreted by activated human macrophages and is markedly elevated in plasma of Gaucher disease patients. The expression of chitotriosidase occurs only at a late stage of differentiation of monocytes to activated macrophages in culture. Human macrophages can synthesize a functional chitotriosidase, a highly conserved enzyme with a strongly regulated expression. This enzyme may play a role in the degradation of chitin-containing pathogens.
• Molecular Weight: 37.730kDa inclusive of tags
• Tissue specificity: Detected in spleen. Secreted by cultured macrophages.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGW NFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDW EYPGSQGSPAVDKERFTTLVQDLANAFQQE
• Sequence Similarities: Belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily.Contains 1 chitin-binding type-2 domain.

Gene Information

• Gene Name: CHIT1 chitinase 1 (chitotriosidase) [ Homo sapiens ]
• Official Symbol: CHIT1
• Synonyms: CHIT1; chitinase 1 (chitotriosidase); chitotriosidase-1; CHI3; CHIT
• Gene ID: 1118
• mRNA Refseq: NM_003465
• Protein Refseq: NP_003456
• MIM: 600031
• Uniprot ID: Q13231
• Chromosome Location: 1q31-q32
• Pathway: Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem
• Function: cation binding; chitin binding; chitinase activity; endochitinase activity