Recombinant Human CHMP5, His-tagged

Cat.No. : CHMP5-27751TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-219 of Human CHMP5, with N terminal His tag; 219 amino acids, 34kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-219 a.a.
Description : CHMP5 belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al.
Conjugation : HIS
Form : Lyophilised:Reconstitution with 151 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDA ELVKYKDQIKKMREGPAKNMVKQKALRVLKQKRMYEQQ RDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEM KKAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYG TPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPE GVPTDTKNKDGVLVDEFGLPQIPAS
Full Length : Full L.
Gene Name CHMP5 charged multivesicular body protein 5 [ Homo sapiens ]
Official Symbol CHMP5
Synonyms CHMP5; charged multivesicular body protein 5; C9orf83, chromatin modifying protein 5 , chromosome 9 open reading frame 83 , SNF7DC2; CGI 34; HSPC177; Vps60;
Gene ID 51510
mRNA Refseq NM_001195536
Protein Refseq NP_001182465
MIM 610900
Uniprot ID Q9NZZ3
Chromosome Location 9p13.3
Pathway ESCRT-III complex, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Endosomal Sorting Complex Required For Transport (ESCRT), organism-specific biosystem; Membrane Trafficking, organism-specific biosystem;
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHMP5 Products

Required fields are marked with *

My Review for All CHMP5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon