Recombinant Full Length Human CHMP5 Protein, GST-tagged
Cat.No. : | CHMP5-3208HF |
Product Overview : | Human CHMP5 full-length ORF (NP_057494.2, 1 a.a. - 219 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 219 amino acids |
Description : | CHMP5 belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 50.9 kDa |
AA Sequence : | MNRLFGKAKPKAPPPSLTGCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPEGVPTDTKNKDGVLVDEFGLPQIPAS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHMP5 charged multivesicular body protein 5 [ Homo sapiens ] |
Official Symbol | CHMP5 |
Synonyms | CHMP5; charged multivesicular body protein 5; C9orf83, chromatin modifying protein 5, chromosome 9 open reading frame 83, SNF7DC2; CGI 34; HSPC177; Vps60; hVps60; SNF7 domain containing 2; chromatin modifying protein 5; chromatin-modifying protein 5; SNF7 domain-containing protein 2; apoptosis-related protein PNAS-2; vacuolar protein sorting-associated protein 60; CGI-34; PNAS-2; C9orf83; SNF7DC2; |
Gene ID | 51510 |
mRNA Refseq | NM_001195536 |
Protein Refseq | NP_001182465 |
MIM | 610900 |
UniProt ID | Q9NZZ3 |
◆ Recombinant Proteins | ||
CHMP5-11189H | Recombinant Human CHMP5, GST-tagged | +Inquiry |
CHMP5-4867H | Recombinant Human CHMP5 protein, His-SUMO-tagged | +Inquiry |
Chmp5-2151M | Recombinant Mouse Chmp5 Protein, Myc/DDK-tagged | +Inquiry |
CHMP5-678R | Recombinant Rhesus Macaque CHMP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHMP5-7172H | Recombinant Human Charged Multivesicular Body Protein 5, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHMP5-7530HCL | Recombinant Human CHMP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHMP5 Products
Required fields are marked with *
My Review for All CHMP5 Products
Required fields are marked with *