Recombinant Human CHRNA1

Cat.No. : CHRNA1-30388TH
Product Overview : Recombinant fragment of Human Nicotinic Acetylcholine Receptor alpha 1 with N terminal proprietary tag, 35.09kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 86 amino acids
Description : The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha isoforms and 1 each of beta, gamma, and delta subunits.2 This gene encodes an alpha subunit that plays a role in acetlycholine binding/channel gating. Alternatively spliced transcript variants encoding different isoforms have been identified.
Molecular Weight : 35.090kDa inclusive of tags
Tissue specificity : Isoform 1 is only expressed in skeletal muscle. Isoform 2 is constitutively expressed in skeletal muscle, brain, heart, kidney, liver, lung and thymus.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRLP
Sequence Similarities : Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-1/CHRNA1 sub-subfamily.
Gene Name CHRNA1 cholinergic receptor, nicotinic, alpha 1 (muscle) [ Homo sapiens ]
Official Symbol CHRNA1
Synonyms CHRNA1; cholinergic receptor, nicotinic, alpha 1 (muscle); cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle) , CHRNA; acetylcholine receptor subunit alpha;
Gene ID 1134
mRNA Refseq NM_000079
Protein Refseq NP_000070
MIM 100690
Uniprot ID P02708
Chromosome Location 2q24-q32
Pathway Acetylcholine Binding And Downstream Events, organism-specific biosystem; Activation of Nicotinic Acetylcholine Receptors, organism-specific biosystem; Effects of Botulinum toxin, organism-specific biosystem; ErbB2/ErbB3 signaling events, organism-specific biosystem; Highly calcium permeable nicotinic acetylcholine receptors, organism-specific biosystem;
Function contributes_to acetylcholine binding; contributes_to acetylcholine receptor activity; acetylcholine-activated cation-selective channel activity; contributes_to acetylcholine-activated cation-selective channel activity; extracellular ligand-gated ion chann;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHRNA1 Products

Required fields are marked with *

My Review for All CHRNA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon