"CHRNA1" Related Products

Expand
Expand
Expand

Recombinant Human CHRNA1

Cat.No.: CHRNA1-30388TH
Product Overview: Recombinant fragment of Human Nicotinic Acetylcholine Receptor alpha 1 with N terminal proprietary tag, 35.09kDa.
Description: The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha isoforms and 1 each of beta, gamma, and delta subunits.2 This gene encodes an alpha subunit that plays a role in acetlycholine binding/channel gating. Alternatively spliced transcript variants encoding different isoforms have been identified.
Protein length: 86 amino acids
Molecular Weight: 35.090kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Isoform 1 is only expressed in skeletal muscle. Isoform 2 is constitutively expressed in skeletal muscle, brain, heart, kidney, liver, lung and thymus.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRLP
Sequence Similarities: Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-1/CHRNA1 sub-subfamily.
Gene Name: CHRNA1 cholinergic receptor, nicotinic, alpha 1 (muscle) [ Homo sapiens ]
Official Symbol: CHRNA1
Synonyms: CHRNA1; cholinergic receptor, nicotinic, alpha 1 (muscle); cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle) , CHRNA; acetylcholine receptor subunit alpha;
Gene ID: 1134
mRNA Refseq: NM_000079
Protein Refseq: NP_000070
MIM: 100690
Uniprot ID: P02708
Chromosome Location: 2q24-q32
Pathway: Acetylcholine Binding And Downstream Events, organism-specific biosystem; Activation of Nicotinic Acetylcholine Receptors, organism-specific biosystem; Effects of Botulinum toxin, organism-specific biosystem; ErbB2/ErbB3 signaling events, organism-specific biosystem; Highly calcium permeable nicotinic acetylcholine receptors, organism-specific biosystem;
Function: contributes_to acetylcholine binding; contributes_to acetylcholine receptor activity; acetylcholine-activated cation-selective channel activity; contributes_to acetylcholine-activated cation-selective channel activity; extracellular ligand-gated ion chann;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.