"CKMT1A" Related Products

Expand

Recombinant Human CKMT1A

Cat.No.: CKMT1A-27113TH
Product Overview: Recombinant fragment corresponding to amino acids 327-417 of Human Creatine kinase MT with an N terminal proprietary tag; Predicted MWt 35.64 kDa.
Description: Mitochondrial creatine (MtCK) kinase is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Many malignant cancers with poor prognosis have shown overexpression of ubiquitous mitochondrial creatine kinase; this may be related to high energy turnover and failure to eliminate cancer cells via apoptosis. Ubiquitous mitochondrial creatine kinase has 80% homology with the coding exons of sarcomeric mitochondrial creatine kinase. Two genes located near each other on chromosome 15 have been identified which encode identical mitochondrial creatine kinase proteins.
Protein length: 91 amino acids
Molecular Weight: 35.640kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH
Gene Name: CKMT1A creatine kinase, mitochondrial 1A [ Homo sapiens ]
Official Symbol: CKMT1A
Synonyms: CKMT1A; creatine kinase, mitochondrial 1A; CKMT1, creatine kinase, mitochondrial 1 (ubiquitous); creatine kinase U-type, mitochondrial;
Gene ID: 548596
mRNA Refseq: NM_001015001
Protein Refseq: NP_001015001
MIM: 613415
Uniprot ID: P12532
Chromosome Location: 15q15
Pathway: Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Creatine metabolism, organism-specific biosystem; Creatine pathway, organism-specific biosystem; Creatine pathway, conserved biosystem;
Function: ATP binding; creatine kinase activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.