Recombinant Human CKMT1A

Cat.No. : CKMT1A-27113TH
Product Overview : Recombinant fragment corresponding to amino acids 327-417 of Human Creatine kinase MT with an N terminal proprietary tag; Predicted MWt 35.64 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 91 amino acids
Description : Mitochondrial creatine (MtCK) kinase is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Many malignant cancers with poor prognosis have shown overexpression of ubiquitous mitochondrial creatine kinase; this may be related to high energy turnover and failure to eliminate cancer cells via apoptosis. Ubiquitous mitochondrial creatine kinase has 80% homology with the coding exons of sarcomeric mitochondrial creatine kinase. Two genes located near each other on chromosome 15 have been identified which encode identical mitochondrial creatine kinase proteins.
Molecular Weight : 35.640kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH
Gene Name CKMT1A creatine kinase, mitochondrial 1A [ Homo sapiens ]
Official Symbol CKMT1A
Synonyms CKMT1A; creatine kinase, mitochondrial 1A; CKMT1, creatine kinase, mitochondrial 1 (ubiquitous); creatine kinase U-type, mitochondrial;
Gene ID 548596
mRNA Refseq NM_001015001
Protein Refseq NP_001015001
MIM 613415
Uniprot ID P12532
Chromosome Location 15q15
Pathway Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Creatine metabolism, organism-specific biosystem; Creatine pathway, organism-specific biosystem; Creatine pathway, conserved biosystem;
Function ATP binding; creatine kinase activity; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CKMT1A Products

Required fields are marked with *

My Review for All CKMT1A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon