"CLC" Related Products

Recombinant Human CLC, His-tagged

Cat.No.: CLC-28114TH
Product Overview: Recombinant full-length Human Galectin 10 with an N terminal His tag; 162 amino acids with the tag; predicted mwt: 18.6 kDa.
Description: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene is a lysophospholipase expressed in eosinophils and basophils. It hydrolyzes lysophosphatidylcholine to glycerophosphocholine and a free fatty acid. This protein may possess carbohydrate or IgE-binding activities. It is both structurally and functionally related to the galectin family of beta-galactoside binding proteins. It may be associated with inflammation and some myeloid leukemias.
Protein length: 162 amino acids
Conjugation: HIS
Molecular Weight: 18.600kDa inclusive of tags
Source: E. coli
Tissue specificity: Expressed exclusively by eosinophils and basophils. Not detected in monocytes and neutrophils.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR
Sequence Similarities: Contains 1 galectin domain.
Gene Name: CLC Charcot-Leyden crystal protein [ Homo sapiens ]
Official Symbol: CLC
Synonyms: CLC; Charcot-Leyden crystal protein; eosinophil lysophospholipase; galectin 10; LGALS10; LPPL_HUMAN; lysolecithin acylhydrolase; MGC149659;
Gene ID: 1178
mRNA Refseq: NM_001828
Protein Refseq: NP_001819
MIM: 153310
Uniprot ID: Q05315
Chromosome Location: 19q13.1
Function: carboxylesterase activity; hydrolase activity; lysophospholipase activity; sugar binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.