Recombinant Human CLC, His-tagged

Cat.No. : CLC-28114TH
Product Overview : Recombinant full-length Human Galectin 10 with an N terminal His tag; 162 amino acids with the tag; predicted mwt: 18.6 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 162 amino acids
Description : Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene is a lysophospholipase expressed in eosinophils and basophils. It hydrolyzes lysophosphatidylcholine to glycerophosphocholine and a free fatty acid. This protein may possess carbohydrate or IgE-binding activities. It is both structurally and functionally related to the galectin family of beta-galactoside binding proteins. It may be associated with inflammation and some myeloid leukemias.
Conjugation : HIS
Molecular Weight : 18.600kDa inclusive of tags
Tissue specificity : Expressed exclusively by eosinophils and basophils. Not detected in monocytes and neutrophils.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR
Sequence Similarities : Contains 1 galectin domain.
Gene Name CLC Charcot-Leyden crystal protein [ Homo sapiens ]
Official Symbol CLC
Synonyms CLC; Charcot-Leyden crystal protein; eosinophil lysophospholipase; galectin 10; LGALS10; LPPL_HUMAN; lysolecithin acylhydrolase; MGC149659;
Gene ID 1178
mRNA Refseq NM_001828
Protein Refseq NP_001819
MIM 153310
Uniprot ID Q05315
Chromosome Location 19q13.1
Function carboxylesterase activity; hydrolase activity; lysophospholipase activity; sugar binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLC Products

Required fields are marked with *

My Review for All CLC Products

Required fields are marked with *

0
cart-icon