Recombinant Human CLC, His-tagged

• Cat.No.: CLC-28114TH
• Product Overview: Recombinant full-length Human Galectin 10 with an N terminal His tag; 162 amino acids with the tag; predicted mwt: 18.6 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 162 amino acids
• Description: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene is a lysophospholipase expressed in eosinophils and basophils. It hydrolyzes lysophosphatidylcholine to glycerophosphocholine and a free fatty acid. This protein may possess carbohydrate or IgE-binding activities. It is both structurally and functionally related to the galectin family of beta-galactoside binding proteins. It may be associated with inflammation and some myeloid leukemias.
• Conjugation: HIS
• Molecular Weight: 18.600kDa inclusive of tags
• Tissue specificity: Expressed exclusively by eosinophils and basophils. Not detected in monocytes and neutrophils.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR
• Sequence Similarities: Contains 1 galectin domain.

Gene Information

• Gene Name: CLC Charcot-Leyden crystal protein [ Homo sapiens ]
• Official Symbol: CLC
• Synonyms: CLC; Charcot-Leyden crystal protein; eosinophil lysophospholipase; galectin 10; LGALS10; LPPL_HUMAN; lysolecithin acylhydrolase; MGC149659
• Gene ID: 1178
• mRNA Refseq: NM_001828
• Protein Refseq: NP_001819
• MIM: 153310
• Uniprot ID: Q05315
• Chromosome Location: 19q13.1
• Function: carboxylesterase activity; hydrolase activity; lysophospholipase activity; sugar binding