Recombinant Human CLC, His-tagged
Cat.No. : | CLC-28114TH |
Product Overview : | Recombinant full-length Human Galectin 10 with an N terminal His tag; 162 amino acids with the tag; predicted mwt: 18.6 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 162 amino acids |
Description : | Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene is a lysophospholipase expressed in eosinophils and basophils. It hydrolyzes lysophosphatidylcholine to glycerophosphocholine and a free fatty acid. This protein may possess carbohydrate or IgE-binding activities. It is both structurally and functionally related to the galectin family of beta-galactoside binding proteins. It may be associated with inflammation and some myeloid leukemias. |
Conjugation : | HIS |
Molecular Weight : | 18.600kDa inclusive of tags |
Tissue specificity : | Expressed exclusively by eosinophils and basophils. Not detected in monocytes and neutrophils. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR |
Sequence Similarities : | Contains 1 galectin domain. |
Gene Name | CLC Charcot-Leyden crystal protein [ Homo sapiens ] |
Official Symbol | CLC |
Synonyms | CLC; Charcot-Leyden crystal protein; eosinophil lysophospholipase; galectin 10; LGALS10; LPPL_HUMAN; lysolecithin acylhydrolase; MGC149659; |
Gene ID | 1178 |
mRNA Refseq | NM_001828 |
Protein Refseq | NP_001819 |
MIM | 153310 |
Uniprot ID | Q05315 |
Chromosome Location | 19q13.1 |
Function | carboxylesterase activity; hydrolase activity; lysophospholipase activity; sugar binding; |
◆ Recombinant Proteins | ||
CLC-13H | Recombinant Human CLC Protein (Ser2-Arg142), N-His tagged, Animal-free, Carrier-free | +Inquiry |
CLC-11272H | Recombinant Human CLC, GST-tagged | +Inquiry |
CLC-4142H | Recombinant Human CLC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CLC-616H | Recombinant Human CLC Protein, His-tagged | +Inquiry |
CLC-1408H | Recombinant Human CLC Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLC-7479HCL | Recombinant Human CLC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLC Products
Required fields are marked with *
My Review for All CLC Products
Required fields are marked with *