"CLEC11A" Related Products

Expand
Expand

Recombinant Human CLEC11A

Cat.No.: CLEC11A-30961TH
Product Overview: Highly pure (>98%) recombinant hIL-11 (human Interleukin-11)
Description: This gene encodes a member of the C-type lectin superfamily. The encoded protein is a secreted sulfated glycoprotein and functions as a growth factor for primitive hematopoietic progenitor cells. An alternative splice variant has been described but its biological nature has not been determined.
Source: E. coli
Tissue specificity: Expressed in skeletal tissues including bone marrow, chondrocytes, primary ossification center-associated cells, the perichondrium and periosteum. Lower levels of expression were detected in spleen, thymus, appendix and fetal liver.
Form: Lyophilised
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGD ENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSP SPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVV ELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRL EGCLKGLRLGHKCFLLSRDFEAQPSASPHPLSPDQPN GGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF
Sequence Similarities: Contains 1 C-type lectin domain.
Gene Name: CLEC11A C-type lectin domain family 11, member A [ Homo sapiens ]
Official Symbol: CLEC11A
Synonyms: CLEC11A; C-type lectin domain family 11, member A; SCGF, stem cell growth factor; lymphocyte secreted C type lectin; C-type lectin domain family 11 member A; CLECSF3; LSLCL; P47;
Gene ID: 6320
mRNA Refseq: NM_002975
Protein Refseq: NP_002966
MIM: 604713
Uniprot ID: Q9Y240
Chromosome Location: 19q13.3
Function: binding; growth factor activity; sugar binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.