"CLEC11A" Related Products

Expand
Expand

Recombinant Human CLEC11A Protein, GST-tagged

Cat.No. : CLEC11A-1453H
Product Overview : Human CLEC11A full-length ORF (BAG36831.1, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene encodes a member of the C-type lectin superfamily. The encoded protein is a secreted sulfated glycoprotein and functions as a growth factor for primitive hematopoietic progenitor cells. An alternative splice variant has been described but its biological nature has not been determined. [provided by RefSeq, Jul 2008]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 61.93 kDa
AA Sequence : MQAAWLLGALVVPQLLGFGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGDENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVVELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRDFEAQAAAQARCTARGGSLAQPADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : CLEC11A C-type lectin domain family 11, member A [ Homo sapiens ]
Official Symbol : CLEC11A
Synonyms : CLEC11A; C-type lectin domain family 11, member A; SCGF, stem cell growth factor; lymphocyte secreted C type lectin; C-type lectin domain family 11 member A; CLECSF3; LSLCL; P47; stem cell growth factor; lymphocyte secreted C-type lectin; C-type lectin superfamily member 3; lymphocyte secreted long form of C-type lectin; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 3; SCGF;
Gene ID : 6320
mRNA Refseq : NM_002975
Protein Refseq : NP_002966
MIM : 604713
UniProt ID : Q9Y240

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.