Recombinant Human CLEC11A Protein, GST-tagged

Cat.No. : CLEC11A-1453H
Product Overview : Human CLEC11A full-length ORF (BAG36831.1, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the C-type lectin superfamily. The encoded protein is a secreted sulfated glycoprotein and functions as a growth factor for primitive hematopoietic progenitor cells. An alternative splice variant has been described but its biological nature has not been determined. [provided by RefSeq, Jul 2008]
Molecular Mass : 61.93 kDa
AA Sequence : MQAAWLLGALVVPQLLGFGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGDENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVVELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRDFEAQAAAQARCTARGGSLAQPADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CLEC11A C-type lectin domain family 11, member A [ Homo sapiens ]
Official Symbol CLEC11A
Synonyms CLEC11A; C-type lectin domain family 11, member A; SCGF, stem cell growth factor; lymphocyte secreted C type lectin; C-type lectin domain family 11 member A; CLECSF3; LSLCL; P47; stem cell growth factor; lymphocyte secreted C-type lectin; C-type lectin superfamily member 3; lymphocyte secreted long form of C-type lectin; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 3; SCGF;
Gene ID 6320
mRNA Refseq NM_002975
Protein Refseq NP_002966
MIM 604713
UniProt ID Q9Y240

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLEC11A Products

Required fields are marked with *

My Review for All CLEC11A Products

Required fields are marked with *

0
cart-icon
0
compare icon