Recombinant Human CLEC11A
| Cat.No. : | CLEC11A-30961TH |
| Product Overview : | Highly pure (>98%) recombinant hIL-11 (human Interleukin-11) |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Description : | This gene encodes a member of the C-type lectin superfamily. The encoded protein is a secreted sulfated glycoprotein and functions as a growth factor for primitive hematopoietic progenitor cells. An alternative splice variant has been described but its biological nature has not been determined. |
| Tissue specificity : | Expressed in skeletal tissues including bone marrow, chondrocytes, primary ossification center-associated cells, the perichondrium and periosteum. Lower levels of expression were detected in spleen, thymus, appendix and fetal liver. |
| Form : | Lyophilised |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGD ENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSP SPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVV ELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRL EGCLKGLRLGHKCFLLSRDFEAQPSASPHPLSPDQPN GGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF |
| Sequence Similarities : | Contains 1 C-type lectin domain. |
| Gene Name | CLEC11A C-type lectin domain family 11, member A [ Homo sapiens ] |
| Official Symbol | CLEC11A |
| Synonyms | CLEC11A; C-type lectin domain family 11, member A; SCGF, stem cell growth factor; lymphocyte secreted C type lectin; C-type lectin domain family 11 member A; CLECSF3; LSLCL; P47; |
| Gene ID | 6320 |
| mRNA Refseq | NM_002975 |
| Protein Refseq | NP_002966 |
| MIM | 604713 |
| Uniprot ID | Q9Y240 |
| Chromosome Location | 19q13.3 |
| Function | binding; growth factor activity; sugar binding; |
| ◆ Recombinant Proteins | ||
| Clec11a-1050M | Active Recombinant Mouse Clec11a Protein, His-tagged | +Inquiry |
| CLEC11A-30961TH | Recombinant Human CLEC11A | +Inquiry |
| CLEC11A-1437R | Recombinant Rat CLEC11A Protein | +Inquiry |
| CLEC11A-1739M | Recombinant Mouse CLEC11A Protein, His (Fc)-Avi-tagged | +Inquiry |
| CLEC11A-1453H | Recombinant Human CLEC11A Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC11A Products
Required fields are marked with *
My Review for All CLEC11A Products
Required fields are marked with *



