Recombinant Human CLEC11A
Cat.No. : | CLEC11A-30961TH |
Product Overview : | Highly pure (>98%) recombinant hIL-11 (human Interleukin-11) |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a member of the C-type lectin superfamily. The encoded protein is a secreted sulfated glycoprotein and functions as a growth factor for primitive hematopoietic progenitor cells. An alternative splice variant has been described but its biological nature has not been determined. |
Source : | E. coli |
Tissue specificity : | Expressed in skeletal tissues including bone marrow, chondrocytes, primary ossification center-associated cells, the perichondrium and periosteum. Lower levels of expression were detected in spleen, thymus, appendix and fetal liver. |
Form : | Lyophilised |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGD ENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSP SPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVV ELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRL EGCLKGLRLGHKCFLLSRDFEAQPSASPHPLSPDQPN GGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF |
Sequence Similarities : | Contains 1 C-type lectin domain. |
Tag : | Non |
Gene Name : | CLEC11A C-type lectin domain family 11, member A [ Homo sapiens ] |
Official Symbol : | CLEC11A |
Synonyms : | CLEC11A; C-type lectin domain family 11, member A; SCGF, stem cell growth factor; lymphocyte secreted C type lectin; C-type lectin domain family 11 member A; CLECSF3; LSLCL; P47; |
Gene ID : | 6320 |
mRNA Refseq : | NM_002975 |
Protein Refseq : | NP_002966 |
MIM : | 604713 |
Uniprot ID : | Q9Y240 |
Chromosome Location : | 19q13.3 |
Function : | binding; growth factor activity; sugar binding; |
Products Types
◆ Recombinant Protein | ||
CLEC11A-1095R | Recombinant Rat CLEC11A Protein, His (Fc)-Avi-tagged | +Inquiry |
CLEC11A-1453H | Recombinant Human CLEC11A Protein, GST-tagged | +Inquiry |
Clec11a-1738M | Recombinant Mouse Clec11a Protein, His (Fc)-Avi-tagged | +Inquiry |
CLEC11A-001H | Recombinant Human CLEC11A Protein, T7-His-TEV-tagged | +Inquiry |
CLEC11A-2188H | Recombinant Human CLEC11A Protein (Ala22-Phe323), N-GST tagged | +Inquiry |
Related Gene
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CLEC11A Products
Required fields are marked with *
My Review for All CLEC11A Products
Required fields are marked with *
0
Inquiry Basket