Recombinant Human CLEC11A
Cat.No. : | CLEC11A-30961TH |
Product Overview : | Highly pure (>98%) recombinant hIL-11 (human Interleukin-11) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | This gene encodes a member of the C-type lectin superfamily. The encoded protein is a secreted sulfated glycoprotein and functions as a growth factor for primitive hematopoietic progenitor cells. An alternative splice variant has been described but its biological nature has not been determined. |
Tissue specificity : | Expressed in skeletal tissues including bone marrow, chondrocytes, primary ossification center-associated cells, the perichondrium and periosteum. Lower levels of expression were detected in spleen, thymus, appendix and fetal liver. |
Form : | Lyophilised |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGD ENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSP SPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVV ELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRL EGCLKGLRLGHKCFLLSRDFEAQPSASPHPLSPDQPN GGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF |
Sequence Similarities : | Contains 1 C-type lectin domain. |
Gene Name | CLEC11A C-type lectin domain family 11, member A [ Homo sapiens ] |
Official Symbol | CLEC11A |
Synonyms | CLEC11A; C-type lectin domain family 11, member A; SCGF, stem cell growth factor; lymphocyte secreted C type lectin; C-type lectin domain family 11 member A; CLECSF3; LSLCL; P47; |
Gene ID | 6320 |
mRNA Refseq | NM_002975 |
Protein Refseq | NP_002966 |
MIM | 604713 |
Uniprot ID | Q9Y240 |
Chromosome Location | 19q13.3 |
Function | binding; growth factor activity; sugar binding; |
◆ Recombinant Proteins | ||
CLEC11A-30960TH | Recombinant Human CLEC11A | +Inquiry |
CLEC11A-50H | Recombinant Human CLEC11A Protein, Gly19-Phe323, C-6×His tagged | +Inquiry |
CLEC11A-1409H | Recombinant Human C-type Lectin Domain Family 11, Member A | +Inquiry |
CLEC11A-1453H | Recombinant Human CLEC11A Protein, GST-tagged | +Inquiry |
CLEC11A-2188H | Recombinant Human CLEC11A Protein (Ala22-Phe323), N-GST tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC11A Products
Required fields are marked with *
My Review for All CLEC11A Products
Required fields are marked with *