"CLIC2" Related Products

Expand
Expand

Recombinant Human CLIC2

Cat.No.: CLIC2-27817TH
Product Overview: Recombinant Full Length Human CLIC2 produced in Saccharomyces cerevisiae; 247 amino acids, MWt 28.3 kDa. 25 kDa proprietary tag is attached.
Description: Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 2 is a member of the p64 family; the protein is detected in fetal liver and adult skeletal muscle tissue.This gene maps to the candidate region on chromosome X for incontinentia pigmenti.
Tissue specificity: Detected in adult brain, heart, liver, lung, spleen, stomach and testis. Expressed in fetal liver and adult skeletal muscle.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids: MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMIL WLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKE LKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLD EIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIK VAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS
Sequence Similarities: Belongs to the chloride channel CLIC family.Contains 1 GST C-terminal domain.
Gene Name: CLIC2 chloride intracellular channel 2 [ Homo sapiens ]
Official Symbol: CLIC2
Synonyms: CLIC2; chloride intracellular channel 2; chloride intracellular channel protein 2; XAP121;
Gene ID: 1193
mRNA Refseq: NM_001289
Protein Refseq: NP_001280
MIM: 300138
Uniprot ID: O15247
Chromosome Location: Xq28
Function: chloride channel activity; voltage-gated chloride channel activity; voltage-gated ion channel activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.