Recombinant Human CLIC2

• Cat.No.: CLIC2-27817TH
• Product Overview: Recombinant Full Length Human CLIC2 produced in Saccharomyces cerevisiae; 247 amino acids, MWt 28.3 kDa. 25 kDa proprietary tag is attached.

Specification

• Species: Human
• Tag: Non
• Description: Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 2 is a member of the p64 family; the protein is detected in fetal liver and adult skeletal muscle tissue.This gene maps to the candidate region on chromosome X for incontinentia pigmenti.
• Tissue specificity: Detected in adult brain, heart, liver, lung, spleen, stomach and testis. Expressed in fetal liver and adult skeletal muscle.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
• Sequences of amino acids: MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMIL WLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKE LKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLD EIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIK VAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS
• Sequence Similarities: Belongs to the chloride channel CLIC family.Contains 1 GST C-terminal domain.
• Full Length: Full L.

Gene Information

• Gene Name: CLIC2 chloride intracellular channel 2 [ Homo sapiens ]
• Official Symbol: CLIC2
• Synonyms: CLIC2; chloride intracellular channel 2; chloride intracellular channel protein 2; XAP121
• Gene ID: 1193
• mRNA Refseq: NM_001289
• Protein Refseq: NP_001280
• MIM: 300138
• Uniprot ID: O15247
• Chromosome Location: Xq28
• Function: chloride channel activity; voltage-gated chloride channel activity; voltage-gated ion channel activity