Recombinant Human CLIC4, His-tagged
Cat.No. : | CLIC4-27273TH |
Product Overview : | Recombinant full length Human CLIC4 with an N terminal His tag; 273 amino acids with a predicted MWt 30.9 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 253 amino acids |
Description : | Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIC4) protein, encoded by the CLIC4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells). |
Conjugation : | HIS |
Molecular Weight : | 30.900kDa inclusive of tags |
Tissue specificity : | Detected in epithelial cells from colon, esophagus and kidney (at protein level). Expression is prominent in heart, kidney, placenta and skeletal muscle. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK |
Sequence Similarities : | Belongs to the chloride channel CLIC family.Contains 1 GST C-terminal domain. |
Gene Name | CLIC4 chloride intracellular channel 4 [ Homo sapiens ] |
Official Symbol | CLIC4 |
Synonyms | CLIC4; chloride intracellular channel 4; chloride intracellular channel protein 4; CLIC4L; DKFZP566G223; H1; huH1; p64H1; P64H1; |
Gene ID | 25932 |
mRNA Refseq | NM_013943 |
Protein Refseq | NP_039234 |
MIM | 606536 |
Uniprot ID | Q9Y696 |
Chromosome Location | 1p |
Function | chloride channel activity; protein binding; voltage-gated chloride channel activity; voltage-gated ion channel activity; |
◆ Recombinant Proteins | ||
Clic4-1430M | Recombinant Mouse Clic4 protein, His-tagged | +Inquiry |
RFL1145HF | Recombinant Full Length Human Chloride Intracellular Channel Protein 4(Clic4) Protein, His-Tagged | +Inquiry |
CLIC4-1647HFL | Recombinant Full Length Human CLIC4 Protein, C-Flag-tagged | +Inquiry |
Clic4-1431R | Recombinant Rat Clic4 protein, His-tagged | +Inquiry |
CLIC4-910R | Recombinant Rhesus monkey CLIC4 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLIC4-7446HCL | Recombinant Human CLIC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLIC4 Products
Required fields are marked with *
My Review for All CLIC4 Products
Required fields are marked with *