Recombinant Human CLIC4, His-tagged

Cat.No. : CLIC4-27273TH
Product Overview : Recombinant full length Human CLIC4 with an N terminal His tag; 273 amino acids with a predicted MWt 30.9 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 253 amino acids
Description : Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIC4) protein, encoded by the CLIC4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells).
Conjugation : HIS
Molecular Weight : 30.900kDa inclusive of tags
Tissue specificity : Detected in epithelial cells from colon, esophagus and kidney (at protein level). Expression is prominent in heart, kidney, placenta and skeletal muscle.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK
Sequence Similarities : Belongs to the chloride channel CLIC family.Contains 1 GST C-terminal domain.
Gene Name CLIC4 chloride intracellular channel 4 [ Homo sapiens ]
Official Symbol CLIC4
Synonyms CLIC4; chloride intracellular channel 4; chloride intracellular channel protein 4; CLIC4L; DKFZP566G223; H1; huH1; p64H1; P64H1;
Gene ID 25932
mRNA Refseq NM_013943
Protein Refseq NP_039234
MIM 606536
Uniprot ID Q9Y696
Chromosome Location 1p
Function chloride channel activity; protein binding; voltage-gated chloride channel activity; voltage-gated ion channel activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLIC4 Products

Required fields are marked with *

My Review for All CLIC4 Products

Required fields are marked with *

0
cart-icon
0
compare icon