"CNN1" Related Products

Expand

Recombinant Human CNN1

Cat.No.: CNN1-27211TH
Product Overview: Recombinant full length Human Calponin with N terminal proprietary tag; Predicted MWt 58.41 kDa, inclusive of tag.
Protein length: 297 amino acids
Molecular Weight: 58.410kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Smooth muscle, and tissues containing significant amounts of smooth muscle.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEG VTGRRIGNNFMDGLKDGIILCEFINKLQPGSVKKINES TQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHT QVQSTLLALASMAKTKGNKVNVGVKYAEKQERKFEPGK LREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD QPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLG MEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCL TPEYPELGEPAHNHHAHNYYNSA
Sequence Similarities: Belongs to the calponin family.Contains 3 calponin-like repeats.Contains 1 CH (calponin-homology) domain.
Gene Name: CNN1 calponin 1, basic, smooth muscle [ Homo sapiens ]
Official Symbol: CNN1
Synonyms: CNN1; calponin 1, basic, smooth muscle; calponin-1; Sm Calp; SMCC;
Gene ID: 1264
mRNA Refseq: NM_001299
Protein Refseq: NP_001290
MIM: 600806
Uniprot ID: P51911
Chromosome Location: 19p13.2-p13.1
Pathway: Myometrial Relaxation and Contraction Pathways, organism-specific biosystem;
Function: actin binding; calmodulin binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.