Recombinant Human CNN1 protein, GST-tagged
Cat.No. : | CNN1-3657H |
Product Overview : | Recombinant Human CNN1 protein(225-265 aa), fused to GST tag, was expressed in E. coli. |
Availability | September 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 225-265 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | KRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPR |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CNN1 calponin 1, basic, smooth muscle [ Homo sapiens ] |
Official Symbol | CNN1 |
Synonyms | CNN1; calponin 1, basic, smooth muscle; calponin-1; Sm Calp; SMCC; basic calponin; calponins, basic; calponin H1, smooth muscle; Sm-Calp; |
Gene ID | 1264 |
mRNA Refseq | NM_001299 |
Protein Refseq | NP_001290 |
MIM | 600806 |
UniProt ID | P51911 |
◆ Recombinant Proteins | ||
CNN1-27211TH | Recombinant Human CNN1 | +Inquiry |
CNN1-2710H | Recombinant Human CNN1 protein, His-SUMO-tagged | +Inquiry |
Cnn1-910M | Recombinant Mouse Cnn1 Protein, MYC/DDK-tagged | +Inquiry |
CNN1-7065C | Recombinant Chicken CNN1 | +Inquiry |
CNN1-1750H | Recombinant Human CNN1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNN1-7406HCL | Recombinant Human CNN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNN1 Products
Required fields are marked with *
My Review for All CNN1 Products
Required fields are marked with *