"CNOT3" Related Products

Expand

Recombinant Human CNOT3

Cat.No.: CNOT3-27807TH
Product Overview: Recombinant fragment of Human CCR4 NOT transcription complex subunit 3 with N terminal proprietary tag; Predicted MW 36.63 kDa.
Description: CCR4-NOT transcription complex subunit 3 is a protein that in humans is encoded by the CNOT3 gene.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Ubiquitous. Highly expressed in brain, heart, thymus, spleen, kidney, liver, small intestine, lung and peripheral blood leukocytes.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNEIKDKRQLIDNRKLIETQMERFKVVERETKT
Sequence Similarities: Belongs to the CNOT2/3/5 family.
Gene Name: CNOT3 CCR4-NOT transcription complex, subunit 3 [ Homo sapiens ]
Official Symbol: CNOT3
Synonyms: CNOT3; CCR4-NOT transcription complex, subunit 3; NOT3; CCR4-NOT transcription complex subunit 3; KIAA0691; LENG2; NOT3 (negative regulator of transcription 3; yeast) homolog; NOT3H;
Gene ID: 4849
mRNA Refseq: NM_014516
Protein Refseq: NP_055331
MIM: 604910
Uniprot ID: O75175
Chromosome Location: 19q13.4
Pathway: Deadenylation of mRNA, organism-specific biosystem; Deadenylation-dependent mRNA decay, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem;
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.