Recombinant Human CNOT3
| Cat.No. : | CNOT3-27807TH |
| Product Overview : | Recombinant fragment of Human CCR4 NOT transcription complex subunit 3 with N terminal proprietary tag; Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | CCR4-NOT transcription complex subunit 3 is a protein that in humans is encoded by the CNOT3 gene. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Ubiquitous. Highly expressed in brain, heart, thymus, spleen, kidney, liver, small intestine, lung and peripheral blood leukocytes. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNEIKDKRQLIDNRKLIETQMERFKVVERETKT |
| Sequence Similarities : | Belongs to the CNOT2/3/5 family. |
| Gene Name | CNOT3 CCR4-NOT transcription complex, subunit 3 [ Homo sapiens ] |
| Official Symbol | CNOT3 |
| Synonyms | CNOT3; CCR4-NOT transcription complex, subunit 3; NOT3; CCR4-NOT transcription complex subunit 3; KIAA0691; LENG2; NOT3 (negative regulator of transcription 3; yeast) homolog; NOT3H; |
| Gene ID | 4849 |
| mRNA Refseq | NM_014516 |
| Protein Refseq | NP_055331 |
| MIM | 604910 |
| Uniprot ID | O75175 |
| Chromosome Location | 19q13.4 |
| Pathway | Deadenylation of mRNA, organism-specific biosystem; Deadenylation-dependent mRNA decay, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem; |
| Function | protein binding; |
| ◆ Recombinant Proteins | ||
| CNOT3-27807TH | Recombinant Human CNOT3 | +Inquiry |
| CNOT3-1814M | Recombinant Mouse CNOT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CNOT3-1937HF | Recombinant Full Length Human CNOT3 Protein, GST-tagged | +Inquiry |
| CNOT3-3666M | Recombinant Mouse CNOT3 Protein | +Inquiry |
| CNOT3-630H | Recombinant Human CNOT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CNOT3-7402HCL | Recombinant Human CNOT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNOT3 Products
Required fields are marked with *
My Review for All CNOT3 Products
Required fields are marked with *
