Recombinant Human COPZ1, His-tagged

• Cat.No.: COPZ1-26340TH
• Product Overview: Recombinant full length Human COPZ1 with an N terminal His tag; 197 amino acids, predicted MWt 22.3kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 177 amino acids
• Description: The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.
• Conjugation: HIS
• Molecular Weight: 22.300kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR
• Sequence Similarities: Belongs to the adaptor complexes small subunit family.

Gene Information

• Gene Name: COPZ1 coatomer protein complex, subunit zeta 1 [ Homo sapiens ]
• Official Symbol: COPZ1
• Synonyms: COPZ1; coatomer protein complex, subunit zeta 1; coatomer protein complex, subunit zeta , COPZ; coatomer subunit zeta-1; CGI 120
• Gene ID: 22818
• mRNA Refseq: NM_016057
• Protein Refseq: NP_057141
• Uniprot ID: P61923
• Chromosome Location: 12q13.2-q13.3
• Pathway: COPI Mediated Transport, organism-specific biosystem; Golgi to ER Retrograde Transport, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem