Recombinant Human COX6A1

• Cat.No.: COX6A1-27583TH
• Product Overview: Recombinant full length Human COX6A1 with N terminal proprietary tag; Predicted MW 37.73 kDa.

Specification

• Description: Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in the electron transfer and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 1 (liver isoform) of subunit VIa, and polypeptide 1 is found in all non-muscle tissues. Polypeptide 2 (heart/muscle isoform) of subunit VIa is encoded by a different gene, and is present only in striated muscles. These two polypeptides share 66% amino acid sequence identity. It has been reported that there may be several pseudogenes on chromosomes 1, 6, 7q21, 7q31-32 and 12. However, only one pseudogene (COX6A1P) on chromosome 1p31.1 has been documented.
• Protein length: 109 amino acids
• Molecular Weight: 37.730kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAVVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKT LTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIR TKPFPWGDGNHTLFHNPHVNPLPTGYEDE
• Sequence Similarities: Belongs to the cytochrome c oxidase subunit 6A family.

Gene Information

• Gene Name: COX6A1 cytochrome c oxidase subunit VIa polypeptide 1 [ Homo sapiens ]
• Official Symbol: COX6A1
• Synonyms: COX6A1; cytochrome c oxidase subunit VIa polypeptide 1; COX6A; cytochrome c oxidase subunit 6A1, mitochondrial
• Gene ID: 1337
• mRNA Refseq: NM_004373
• Protein Refseq: NP_004364
• MIM: 602072
• Uniprot ID: P12074
• Chromosome Location: 12q24
• Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Cardiac muscle contraction, organism-specific biosystem; Cardiac muscle contraction, conserved biosystem; Cytochrome c oxidase, organism-specific biosystem
• Function: cytochrome-c oxidase activity