"COX6A1" Related Products

Expand

Recombinant Human COX6A1

Cat.No.: COX6A1-27583TH
Product Overview: Recombinant full length Human COX6A1 with N terminal proprietary tag; Predicted MW 37.73 kDa.
Description: Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in the electron transfer and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 1 (liver isoform) of subunit VIa, and polypeptide 1 is found in all non-muscle tissues. Polypeptide 2 (heart/muscle isoform) of subunit VIa is encoded by a different gene, and is present only in striated muscles. These two polypeptides share 66% amino acid sequence identity. It has been reported that there may be several pseudogenes on chromosomes 1, 6, 7q21, 7q31-32 and 12. However, only one pseudogene (COX6A1P) on chromosome 1p31.1 has been documented.
Protein length: 109 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAVVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKT LTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIR TKPFPWGDGNHTLFHNPHVNPLPTGYEDE
Sequence Similarities: Belongs to the cytochrome c oxidase subunit 6A family.
Gene Name: COX6A1 cytochrome c oxidase subunit VIa polypeptide 1 [ Homo sapiens ]
Official Symbol: COX6A1
Synonyms: COX6A1; cytochrome c oxidase subunit VIa polypeptide 1; COX6A; cytochrome c oxidase subunit 6A1, mitochondrial;
Gene ID: 1337
mRNA Refseq: NM_004373
Protein Refseq: NP_004364
MIM: 602072
Uniprot ID: P12074
Chromosome Location: 12q24
Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Cardiac muscle contraction, organism-specific biosystem; Cardiac muscle contraction, conserved biosystem; Cytochrome c oxidase, organism-specific biosystem;
Function: cytochrome-c oxidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.