Recombinant Human CPT1A

Cat.No. : CPT1A-26794TH
Product Overview : Recombinant fragment corresponding to amino acids 461-550 of Human CPT1A with an N terminal proprietary tag; Predicted MWt 35.53 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 90 amino acids
Description : The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 35.530kDa inclusive of tags
Tissue specificity : Strong expression in kidney and heart, and lower in liver and skeletal muscle.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFP
Sequence Similarities : Belongs to the carnitine/choline acetyltransferase family.
Gene Name CPT1A carnitine palmitoyltransferase 1A (liver) [ Homo sapiens ]
Official Symbol CPT1A
Synonyms CPT1A; carnitine palmitoyltransferase 1A (liver); CPT1; carnitine O-palmitoyltransferase 1, liver isoform; CPT1 L; L CPT1;
Gene ID 1374
mRNA Refseq NM_001031847
Protein Refseq NP_001027017
MIM 600528
Uniprot ID P50416
Chromosome Location 11q13.2
Pathway AMPK signaling, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Fatty Acid Beta Oxidation, organism-specific biosystem;
Function carnitine O-palmitoyltransferase activity; identical protein binding; transferase activity, transferring acyl groups;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CPT1A Products

Required fields are marked with *

My Review for All CPT1A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon